DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and B0564.6

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_502527.1 Gene:B0564.6 / 182046 WormBaseID:WBGene00007206 Length:423 Species:Caenorhabditis elegans


Alignment Length:216 Identity:55/216 - (25%)
Similarity:84/216 - (38%) Gaps:64/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLIPQVAVYLSLKDLFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAFRVLARCCQRLEV 113
            |.:.....:|.|....||..|.:.|:      |...:.|.|..|.....|.:.:::.:.|.:||.
 Worm   238 VAMADTITHLDLSRSVNLLDCRQIAE------LVNLRHLSLKNNKEGVRDDSLQLIIKNCSKLEE 296

  Fly   114 LHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTG 178
            |.|.||.:||...|:.|          .|||   |:..||| |.||...:...|::|:|      
 Worm   297 LSLDCCEYLTVNSLITL----------GNLN---NLKQLSL-PGIVNVDDSVCLQISRC------ 341

  Fly   179 AVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELE 243
                     |||...:|::|..:.:|.|:..   |:.||                       .|:
 Worm   342 ---------SKLTYLNINFCRRVQKRGLLCL---LSCLT-----------------------SLD 371

  Fly   244 HINVIGCAAISDYGVHALTVH 264
            |:.|:|..|   |..|.|.:|
 Worm   372 HLEVLGIRA---YSHHLLALH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 5/24 (21%)
AMN1 96..>261 CDD:187754 42/164 (26%)
leucine-rich repeat 111..137 CDD:275381 10/25 (40%)
leucine-rich repeat 138..163 CDD:275381 10/24 (42%)
leucine-rich repeat 164..189 CDD:275381 3/24 (13%)
leucine-rich repeat 190..215 CDD:275381 6/24 (25%)
leucine-rich repeat 216..241 CDD:275381 2/24 (8%)
leucine-rich repeat 242..267 CDD:275381 9/23 (39%)
leucine-rich repeat 268..290 CDD:275381
B0564.6NP_502527.1 leucine-rich repeat 106..130 CDD:275381
leucine-rich repeat 131..159 CDD:275381
leucine-rich repeat 166..193 CDD:275381
leucine-rich repeat 195..214 CDD:275381
leucine-rich repeat 219..243 CDD:275381 1/4 (25%)
leucine-rich repeat 244..266 CDD:275381 7/27 (26%)
leucine-rich repeat 267..293 CDD:275381 5/25 (20%)
leucine-rich repeat 294..318 CDD:275381 13/36 (36%)
leucine-rich repeat 319..343 CDD:275381 9/39 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.