DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and T01E8.1

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001364580.1 Gene:T01E8.1 / 174584 WormBaseID:WBGene00011331 Length:516 Species:Caenorhabditis elegans


Alignment Length:258 Identity:68/258 - (26%)
Similarity:104/258 - (40%) Gaps:67/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LKDLFNLRCCSRTAQRFVEAAL-----EKRQEL--------HLSGNNTKNIDVAFRVLARCCQRL 111
            :|.|.|| |.|...|..:.:.|     |.||:|        .||.::...               
 Worm     2 VKSLLNL-CLSAVCQHELNSELSFIPVECRQKLLEFFCSHDQLSASDCST--------------- 50

  Fly   112 EVLHLACCRW---------------LTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVEC 161
                |.|.::               ||||:|..|..|| |.:..:.|.:|.|:|.|..|.:....
 Worm    51 ----LVCSKYFGCNIPSLTFYLSAELTDEMLNQLTTNN-KYVEKITLVDCPNVTNLGAQAVTTGQ 110

  Fly   162 KELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAI---GERCLIIFFRKLNKLTVLSLAN 223
            ..||.|:|.....||...::  .::...|...|:|.||.|   |.|.|:|   |...:..|.|.:
 Worm   111 ILLRQLELRAMHQLTDQCLE--NVYSPFLYSVDLSGCGKITSQGIRTLLI---KNPTIGCLYLNH 170

  Fly   224 TPSVTDQVLIQIGNYCRELEHINVIGC-AAISDYGVHALTVHCLRLRTLLIRRCPRVTELSLA 285
            ..|:.||||..|.:|..:..|:..:.. .:::|   .|..:|      .|..:||.:::||||
 Worm   171 CRSLDDQVLYDIAHYVGDRLHVLELDFPTSLAD---PAAALH------YLSSQCPNLSQLSLA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 4/32 (13%)
AMN1 96..>261 CDD:187754 45/183 (25%)
leucine-rich repeat 111..137 CDD:275381 10/40 (25%)
leucine-rich repeat 138..163 CDD:275381 6/24 (25%)
leucine-rich repeat 164..189 CDD:275381 6/24 (25%)
leucine-rich repeat 190..215 CDD:275381 11/27 (41%)
leucine-rich repeat 216..241 CDD:275381 9/24 (38%)
leucine-rich repeat 242..267 CDD:275381 4/25 (16%)
leucine-rich repeat 268..290 CDD:275381 7/18 (39%)
T01E8.1NP_001364580.1 leucine-rich repeat 190..217 CDD:275381 6/35 (17%)
leucine-rich repeat 328..352 CDD:275381
leucine-rich repeat 353..382 CDD:275381
leucine-rich repeat 383..407 CDD:275381
leucine-rich repeat 408..433 CDD:275381
AMN1 <430..>512 CDD:187754
leucine-rich repeat 434..452 CDD:275381
leucine-rich repeat 459..483 CDD:275381
leucine-rich repeat 484..510 CDD:275381
leucine-rich repeat 61..86 CDD:275381 8/25 (32%)
AMN1 <69..203 CDD:187754 42/139 (30%)
leucine-rich repeat 87..112 CDD:275381 6/24 (25%)
leucine-rich repeat 113..136 CDD:275381 6/24 (25%)
leucine-rich repeat 137..162 CDD:275381 11/27 (41%)
leucine-rich repeat 163..189 CDD:275381 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.