DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and FBXL16

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_699181.2 Gene:FBXL16 / 146330 HGNCID:14150 Length:479 Species:Homo sapiens


Alignment Length:346 Identity:75/346 - (21%)
Similarity:125/346 - (36%) Gaps:74/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AMASG-----GQPTRTASP-----RPLVTASIAAPRSLF------------DVC--WDDVLI-PQ 53
            |:|.|     |.|....:|     ||.:.........||            .||  |..||. |:
Human    68 ALAGGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQVCKAWRRVLYQPK 132

  Fly    54 ----VAVYLSLKDLFN------------------------------LRCCSRTAQRFVE-AALEK 83
                :...|..|:|:|                              |..|     .|:: .||.|
Human   133 FWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDIC-----EFIDNYALSK 192

  Fly    84 RQELHLSGNNTKNIDVAFRVLARCCQRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVN 148
            :....:|...:...|....|:....|.:..|.|:.|...|:..|...|:   .|:.::::::|:|
Human   193 KGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLS---ARITSLSVSDCIN 254

  Fly   149 ITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVE-FDISYCGAIGERCLIIFFRK 212
            :...::..|......|..|.| :...:|..|:...|..|..... ..:..|..|....::.....
Human   255 VADDAIAAISQLLPNLAELSL-QAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHS 318

  Fly   213 LNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCP 277
            |..||.|||:....|||..:..:....|:|..:::..|..|:|..:..:.....||..|::.||.
Human   319 LPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCV 383

  Fly   278 RVTELSLAPLRQ----RRLYI 294
            |:|:..|:.|..    |.||:
Human   384 RITDTGLSYLSTMSSLRSLYL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 3/24 (13%)
AMN1 96..>261 CDD:187754 36/165 (22%)
leucine-rich repeat 111..137 CDD:275381 6/25 (24%)
leucine-rich repeat 138..163 CDD:275381 3/24 (13%)
leucine-rich repeat 164..189 CDD:275381 7/24 (29%)
leucine-rich repeat 190..215 CDD:275381 3/25 (12%)
leucine-rich repeat 216..241 CDD:275381 8/24 (33%)
leucine-rich repeat 242..267 CDD:275381 4/24 (17%)
leucine-rich repeat 268..290 CDD:275381 8/25 (32%)
FBXL16NP_699181.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
AMN1 201..413 CDD:332986 48/208 (23%)
leucine-rich repeat 220..243 CDD:275381 6/25 (24%)
leucine-rich repeat 244..269 CDD:275381 3/24 (13%)
LRR 1 244..266 3/21 (14%)
LRR 2 267..290 5/23 (22%)
leucine-rich repeat 270..295 CDD:275381 7/25 (28%)
leucine-rich repeat 296..321 CDD:275381 3/24 (13%)
LRR 3 319..343 9/23 (39%)
leucine-rich repeat 322..347 CDD:275381 8/24 (33%)
LRR 4 345..369 5/23 (22%)
leucine-rich repeat 348..373 CDD:275381 4/24 (17%)
LRR 5 371..395 9/23 (39%)
leucine-rich repeat 374..398 CDD:275381 8/23 (35%)
LRR 6 396..420 3/9 (33%)
LRR 7 446..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.