Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689654.1 | Gene: | FBXL14 / 144699 | HGNCID: | 28624 | Length: | 418 | Species: | Homo sapiens |
Alignment Length: | 251 | Identity: | 63/251 - (25%) |
---|---|---|---|
Similarity: | 110/251 - (43%) | Gaps: | 12/251 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 DVLIPQVAVYLSLKDLFNLRCCS---RTAQRFVEAALEKRQEL------HLSGNNTKNIDVAFRV 103
Fly 104 LARCCQRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLK 168
Fly 169 LSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLI 233
Fly 234 QIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCPRVTELSLAPLRQ 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 7/30 (23%) |
AMN1 | 96..>261 | CDD:187754 | 43/164 (26%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 10/25 (40%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 6/22 (27%) | ||
FBXL14 | NP_689654.1 | Required for down-regulation of SNAI1 | 2..48 | ||
F-box-like | 5..46 | CDD:403981 | |||
AMN1 | 90..296 | CDD:187754 | 43/165 (26%) | ||
leucine-rich repeat | 92..118 | CDD:275381 | |||
leucine-rich repeat | 119..142 | CDD:275381 | 2/9 (22%) | ||
LRR 1 | 144..163 | 4/18 (22%) | |||
leucine-rich repeat | 145..170 | CDD:275381 | 5/24 (21%) | ||
LRR 2 | 170..191 | 4/20 (20%) | |||
leucine-rich repeat | 171..203 | CDD:275381 | 7/31 (23%) | ||
LRR 3 | 203..225 | 10/22 (45%) | |||
leucine-rich repeat | 204..229 | CDD:275381 | 10/25 (40%) | ||
AMN1 | 228..401 | CDD:187754 | 37/154 (24%) | ||
LRR 4 | 229..250 | 6/21 (29%) | |||
leucine-rich repeat | 230..254 | CDD:275381 | 6/24 (25%) | ||
LRR 5 | 254..275 | 5/20 (25%) | |||
leucine-rich repeat | 255..280 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 281..306 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 307..331 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 332..357 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 358..382 | CDD:275381 | 6/22 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |