DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Ppa

DIOPT Version :10

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_061513870.1 Gene:Ppa / 1279716 VectorBaseID:AGAMI1_003831 Length:499 Species:Anopheles gambiae


Alignment Length:48 Identity:12/48 - (25%)
Similarity:20/48 - (41%) Gaps:18/48 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCDCALC--------MIVYDTPIF----LYSGTWCYD----EPLKNIL 42
            :||  ||        .:.:|.|.|    .||.:|..:    |..:|::
Mosquito    85 ICD--LCESPKTSELRVAHDAPTFQTTYSYSISWDVEMDDVEHYRNVM 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 F-box_FBXL15 41..84 CDD:438898 0/2 (0%)
leucine-rich repeat 85..110 CDD:275381
AMN1 96..>261 CDD:187754
leucine-rich repeat 111..137 CDD:275381
leucine-rich repeat 138..163 CDD:275381
leucine-rich repeat 164..189 CDD:275381
leucine-rich repeat 190..215 CDD:275381
leucine-rich repeat 216..241 CDD:275381
leucine-rich repeat 242..267 CDD:275381
leucine-rich repeat 268..290 CDD:275381
PpaXP_061513870.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.