DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and LOC1275331

DIOPT Version :10

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_061515610.1 Gene:LOC1275331 / 1275331 VectorBaseID:AGAMI1_002875 Length:252 Species:Anopheles gambiae


Alignment Length:219 Identity:46/219 - (21%)
Similarity:73/219 - (33%) Gaps:72/219 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 QRLEVLHLACCRWLTDEL----------LLPLLANN-----------------------KKRLWA 140
            |:.|.|..:|.|::...|          |||.|..|                       ...|..
Mosquito     7 QQPETLFHSCIRFVAKNLQLYKNIEYLELLPALVKNAIFLNVVRVHKGFHDEELPRLLLNSSLTR 71

  Fly   141 VNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERC 205
            |||:.. .||...|..:..:|..||.|.||:..:..|..                ..|..|    
Mosquito    72 VNLSTS-TITDGLLALLAEKCPHLRSLTLSEGNYRFTRP----------------GLCAMI---- 115

  Fly   206 LIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALT-VHCLR-- 267
                 ::|.||..|...|.|.|.|:.:..:...|.:|:.:::..|..:.|....:|: :..:|  
Mosquito   116 -----QRLGKLQHLYAKNCPQVDDEFVRLLATSCPQLDTLDLESCKQVGDGSADSLSGMPLVRLN 175

  Fly   268 ----------LRTLLIRRCPRVTE 281
                      |:|:...||.:..|
Mosquito   176 LSYTSITDKFLKTIANERCGKTLE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 F-box_FBXL15 41..84 CDD:438898