DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and fbxl13

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_017209779.1 Gene:fbxl13 / 101883454 ZFINID:ZDB-GENE-140106-120 Length:796 Species:Danio rerio


Alignment Length:280 Identity:76/280 - (27%)
Similarity:121/280 - (43%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SLFDVCWDDVLIP--QVAVYLSLKDLFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAFR 102
            :|.|:| ..||:.  ::...:||.:..||   |..|.:.|...::..:.| :.||:... |.:.:
Zfish   461 TLTDIC-VQVLVSRCRMLTVISLLESLNL---SDVAFKAVAEVIDLTKIL-IEGNDVIT-DSSVK 519

  Fly   103 VLARCCQRLEVLHLACCRWLTDELL-----LPLLAN---------------------NKKRLWAV 141
            .|.|.|.:|..|||:||..:||...     |..|.|                     :..:|..:
Zfish   520 ALCRSCLKLSELHLSCCPRVTDACFKTLGNLTKLCNLNISGCFKVTDMGLHYITEGPSAGQLREL 584

  Fly   142 NLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYC-------G 199
            :|:.|:.||.|||:.|..:|..|..|.|..|:.||....:.|. ..|.|:..|||.|       .
Zfish   585 DLSYCLKITDLSLRRISQKCISLTNLALCFCENLTDNGFECLD-KCSSLISLDISGCKIHDKGLS 648

  Fly   200 AIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVH 264
            |:|..         ..|..||.|....:||..:......|:.||.::|..|..:||..:.||:..
Zfish   649 ALGAN---------PSLRKLSAAECVFITDIGIKMFCRLCQRLELLDVCQCVRLSDRAIKALSFF 704

  Fly   265 CLRLRTLLIRRCPRVTELSL 284
            |..:.|:.|..||::|:.::
Zfish   705 CRTIATVRIAGCPKMTDAAV 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 7/24 (29%)
AMN1 96..>261 CDD:187754 53/197 (27%)
leucine-rich repeat 111..137 CDD:275381 11/51 (22%)
leucine-rich repeat 138..163 CDD:275381 10/24 (42%)
leucine-rich repeat 164..189 CDD:275381 7/24 (29%)
leucine-rich repeat 190..215 CDD:275381 7/31 (23%)
leucine-rich repeat 216..241 CDD:275381 7/24 (29%)
leucine-rich repeat 242..267 CDD:275381 9/24 (38%)
leucine-rich repeat 268..290 CDD:275381 5/17 (29%)
fbxl13XP_017209779.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.