DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and fbxl20

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_004918731.1 Gene:fbxl20 / 100491064 XenbaseID:XB-GENE-979487 Length:516 Species:Xenopus tropicalis


Alignment Length:343 Identity:89/343 - (25%)
Similarity:144/343 - (41%) Gaps:68/343 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HLMAMASGGQPTRTA-------------------SPRPLVTASIAAP---------RSLFDVCW- 46
            |....|.|..|:.||                   .|:.|||.: |||         :|.|::.. 
 Frog    34 HWHFRAQGPGPSVTAPPPIGPHYIRCEPGNSGEKGPQHLVTHT-AAPMRRDMNGVTKSRFEMFSN 97

  Fly    47 -DDVLI----PQVAV--YLSLKDLFNLRCCSRTAQRFVEAALE----KRQEL-----HLSGNNTK 95
             |:.||    |:..:  ..|..|:..|..|::.::.:...||:    :|.:|     .:.|...:
 Frog    98 NDEALINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDFQRDIEGRVVE 162

  Fly    96 NI--------------------DVAFRVLARCCQRLEVLHLACCRWLTDELLLPLLANNKKRLWA 140
            ||                    |.|.|..|:.|:.:|||:|..|..:||..... |:....:|..
 Frog   163 NISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTS-LSKFCSKLRQ 226

  Fly   141 VNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERC 205
            ::|..|.:||.|||:.|...|.:|..|.:|.|..::...:.||......|....:..|..:.:..
 Frog   227 LDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEA 291

  Fly   206 LIIFFRKLNKLTVLSL-ANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLR 269
            |........:|..|:| |.:..:||..||.|...|.:|:.:...||:.|:|..::||..:|.|||
 Frog   292 LKFIGSHCPELVTLNLQACSQQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLR 356

  Fly   270 TLLIRRCPRVTELSLAPL 287
            .|.:.||.::|:|....|
 Frog   357 ILEVARCSQLTDLGFTTL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 9/49 (18%)
AMN1 96..>261 CDD:187754 49/185 (26%)
leucine-rich repeat 111..137 CDD:275381 8/25 (32%)
leucine-rich repeat 138..163 CDD:275381 10/24 (42%)
leucine-rich repeat 164..189 CDD:275381 6/24 (25%)
leucine-rich repeat 190..215 CDD:275381 3/24 (13%)
leucine-rich repeat 216..241 CDD:275381 10/25 (40%)
leucine-rich repeat 242..267 CDD:275381 8/24 (33%)
leucine-rich repeat 268..290 CDD:275381 8/20 (40%)
fbxl20XP_004918731.1 F-box-like 107..149 CDD:289689 8/41 (20%)
leucine-rich repeat 144..171 CDD:275381 5/26 (19%)
AMN1 172..369 CDD:187754 57/197 (29%)
leucine-rich repeat 172..197 CDD:275381 5/24 (21%)
leucine-rich repeat 198..220 CDD:275381 8/22 (36%)
leucine-rich repeat 224..249 CDD:275381 10/24 (42%)
leucine-rich repeat 250..275 CDD:275381 6/24 (25%)
leucine-rich repeat 276..301 CDD:275381 3/24 (13%)
AMN1 299..474 CDD:187754 27/76 (36%)
leucine-rich repeat 302..328 CDD:275381 10/25 (40%)
leucine-rich repeat 329..354 CDD:275381 8/24 (33%)
leucine-rich repeat 355..380 CDD:275381 8/20 (40%)
leucine-rich repeat 381..406 CDD:275381
leucine-rich repeat 407..429 CDD:275381
leucine-rich repeat 436..455 CDD:275381
leucine-rich repeat 461..486 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.