| Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001344855.1 | Gene: | si:dkey-192l18.9 / 100005961 | ZFINID: | ZDB-GENE-120709-25 | Length: | 476 | Species: | Danio rerio |
| Alignment Length: | 345 | Identity: | 87/345 - (25%) |
|---|---|---|---|
| Similarity: | 143/345 - (41%) | Gaps: | 86/345 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 TRTASPRPLVTASIAAPRSLFDVCWDDVLIPQVAVYLSLKDLFNLRC-CSRTAQRFVEAALEKR- 84
Fly 85 -QELHLSG-----------------NNTKNI----------------DVAFRVLARCCQRLEVLH 115
Fly 116 LACCRWLTDELLLPLLAN--NKKRLWA-------------------------------VNLNECV 147
Fly 148 NITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRK 212
Fly 213 LNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCP 277
Fly 278 RVTELSLAPLRQ-----RRL 292 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 11/57 (19%) |
| AMN1 | 96..>261 | CDD:187754 | 50/213 (23%) | ||
| leucine-rich repeat | 111..137 | CDD:275381 | 5/27 (19%) | ||
| leucine-rich repeat | 138..163 | CDD:275381 | 7/55 (13%) | ||
| leucine-rich repeat | 164..189 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 190..215 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 216..241 | CDD:275381 | 9/24 (38%) | ||
| leucine-rich repeat | 242..267 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 268..290 | CDD:275381 | 8/26 (31%) | ||
| si:dkey-192l18.9 | XP_001344855.1 | F-box-like | 99..145 | CDD:289689 | 13/50 (26%) |
| leucine-rich repeat | 114..138 | CDD:275381 | 7/27 (26%) | ||
| leucine-rich repeat | 139..172 | CDD:275381 | 4/32 (13%) | ||
| leucine-rich repeat | 173..198 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 199..220 | CDD:275381 | 4/20 (20%) | ||
| LRR_CC | 222..246 | CDD:197685 | 2/23 (9%) | ||
| leucine-rich repeat | 225..258 | CDD:275381 | 1/32 (3%) | ||
| leucine-rich repeat | 259..284 | CDD:275381 | 6/24 (25%) | ||
| AMN1 | 280..465 | CDD:187754 | 45/139 (32%) | ||
| leucine-rich repeat | 285..310 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 311..336 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 337..362 | CDD:275381 | 9/24 (38%) | ||
| leucine-rich repeat | 363..388 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 389..414 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 415..440 | CDD:275381 | 3/4 (75%) | ||
| leucine-rich repeat | 441..465 | CDD:275381 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||