DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and si:ch211-214j8.12

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001091661.1 Gene:si:ch211-214j8.12 / 100000539 ZFINID:ZDB-GENE-060526-102 Length:627 Species:Danio rerio


Alignment Length:221 Identity:56/221 - (25%)
Similarity:84/221 - (38%) Gaps:44/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WLTDE--------LLLPLLANNKKRLWAVNLNECVN--------ITALSLQPIIVECKELRVLKL 169
            |..||        |.|..||.|.|.|||.:..:...        :...||.|  .|..|..:..|
Zfish    22 WTEDEEKPSTLIGLCLQSLAENMKELWAKDYAQKYMDQYFFRYIMGPFSLLP--GELLEELLCIL 84

  Fly   170 SKCQWLTTGAVDALTLHQSKLVEF-------DISYCGAIGERCLIIFFRKLNKLTVLSLANTPSV 227
            |....||..|:..|.|.|...:..       :.|.|..|..||        ..|..|.|:.:.::
Zfish    85 SSRNLLTRAALHLLLLPQLSSLSLASACSLVNASLCSLIQIRC--------QNLQSLDLSGSQNI 141

  Fly   228 TDQVLIQIGNYCRELEHINVIGCAAISDYGV-HALTVHCLRLRTLLIRRCPRVTELSLAPLRQRR 291
            :..||.::......|..:::.|  .:.|..| ..|::.|.:|:.|.:.||..:|...|.||..|.
Zfish   142 SASVLCELLGSQHRLRSLSLAG--TLCDQKVMSVLSLQCPKLKHLDVSRCLHLTPAGLLPLAYRE 204

  Fly   292 LYIDRPQP-------DVGLNAYNLND 310
            .:::....       |:|| |.|..|
Zfish   205 AHVNSTNTISSLLALDIGL-AENEGD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381
AMN1 96..>261 CDD:187754 39/163 (24%)
leucine-rich repeat 111..137 CDD:275381 8/23 (35%)
leucine-rich repeat 138..163 CDD:275381 7/32 (22%)
leucine-rich repeat 164..189 CDD:275381 8/24 (33%)
leucine-rich repeat 190..215 CDD:275381 5/31 (16%)
leucine-rich repeat 216..241 CDD:275381 5/24 (21%)
leucine-rich repeat 242..267 CDD:275381 6/25 (24%)
leucine-rich repeat 268..290 CDD:275381 8/21 (38%)
si:ch211-214j8.12NP_001091661.1 AMN1 122..>201 CDD:187754 21/88 (24%)
leucine-rich repeat 130..155 CDD:275381 5/24 (21%)
leucine-rich repeat 156..180 CDD:275381 6/25 (24%)
leucine-rich repeat 181..215 CDD:275381 9/33 (27%)
leucine-rich repeat 216..243 CDD:275381 6/15 (40%)
leucine-rich repeat 314..368 CDD:275381
leucine-rich repeat 403..427 CDD:275381
leucine-rich repeat 428..453 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.