DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL24 and MRPL40

DIOPT Version :9

Sequence 1:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_015152.1 Gene:MRPL40 / 855930 SGDID:S000006094 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:52/266 - (19%)
Similarity:90/266 - (33%) Gaps:92/266 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LKNFSNLPKEYIERSKKQVYWQTPKEINYLPRTVERKRFRYTTNRSWTGQFRQQNMPGTVRRKVL 75
            :|...|.||.::..|:|.:...||:.:....:.|:.|.           .|:.:           
Yeast    16 MKRLGNRPKNFLPHSEKFIKKSTPEFMKSDLKEVDEKT-----------SFKSE----------- 58

  Fly    76 VEPIEDWSFFRGDRIEVLVGKDKGKQGIV-------------------TQVIPERNWVIVEGLNW 121
                ::|.|..|||:.|:.|..||...::                   |..:|::.|  :||...
Yeast    59 ----KEWKFIPGDRVVVMSGASKGNIAVIKSFDKRTNSFILDENGPTKTVPVPKQFW--LEGQTS 117

  Fly   122 HYRKVGGEKEFPGIIIKSEAPLHVT-KDIRLVDPSDLQGTDFEWRFTEEGEKVRVSLRSGRIIPI 185
            |...:               |:.:. ||:|||...|.:.|        .|:...|::|.      
Yeast   118 HMITI---------------PVSILGKDLRLVADIDDEKT--------PGKTRTVAVRD------ 153

  Fly   186 PETNNQTH--DYK----------TPNAYIEREKDTPGAVVGEITFQPKLS---TFEMDIMEEMGI 235
            ...|...:  |||          .|:..|...|..|..|...:...|.::   ||.:|.:....|
Yeast   154 VSFNGSYYDADYKKVMPYRCVKGQPDLIIPWPKPDPIDVQTNLATDPVIAREQTFWVDSVVRNPI 218

  Fly   236 KEERTP 241
            .::..|
Yeast   219 PKKAIP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL24NP_523476.1 rplX 86..183 CDD:234566 24/116 (21%)
MRPL40NP_015152.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.