DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL24 and RPL24

DIOPT Version :9

Sequence 1:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_851190.1 Gene:RPL24 / 835549 AraportID:AT5G54600 Length:198 Species:Arabidopsis thaliana


Alignment Length:98 Identity:29/98 - (29%)
Similarity:57/98 - (58%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GDRIEVLVGKDKGKQGIVTQVIPERNWVIVEGLNWHYRKVGGEKE-FPGIIIKSEAPLHVTKDIR 150
            ||.::|:.|:||||.|.||::....:.::::.:|...:.:...:| .||.|:|.|||:| :.::.
plant    76 GDTVKVISGRDKGKIGEVTKIFTHNSTIVIKDVNLKTKHMKSREEGEPGQIVKIEAPIH-SSNVM 139

  Fly   151 LVDPSDLQGTDFEWRFTEEGEKVRVSLRSGRII 183
            |........:....:..|:|:|||..:::|.:|
plant   140 LYSKEKDVVSRVGHKVLEDGQKVRYLIKTGELI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL24NP_523476.1 rplX 86..183 CDD:234566 28/96 (29%)
RPL24NP_851190.1 rplX 70..173 CDD:234566 29/98 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1007373at2759
OrthoFinder 1 1.000 - - FOG0004182
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101141
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.