DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL24 and AT5G23535

DIOPT Version :9

Sequence 1:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001331693.1 Gene:AT5G23535 / 832419 AraportID:AT5G23535 Length:159 Species:Arabidopsis thaliana


Alignment Length:146 Identity:54/146 - (36%)
Similarity:75/146 - (51%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IEDWSFFRGDRIEVLVGKDKGKQGIVTQVIPERNWVIVEGLNWHYRKVGGEKEFPGIIIKSEAPL 143
            |..|...|||.:.::.|||||:.|.:.:||..:|.|||||.|...:.:.|..:..|.|...||||
plant    10 IRHWKILRGDNVMIIRGKDKGETGTIKRVIRSQNRVIVEGKNLIKKHIKGGPDHEGGIFTVEAPL 74

  Fly   144 HVTKDIRLVDPSDLQGTDFEWRFTEEGEKVRVSL---RSGRIIPIPETNNQTHDYKTPNAYIERE 205
            |.: ::::|||...:......::.|:|.||||:.   .||.|||.||.   .....||.......
plant    75 HAS-NVQVVDPVTGRPCKVGVKYLEDGTKVRVARGTGTSGSIIPRPEI---LKIRATPRPTTAGP 135

  Fly   206 KDTPGAVVGEITFQPK 221
            ||||...|.|.|:..|
plant   136 KDTPMEFVWEQTYDAK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL24NP_523476.1 rplX 86..183 CDD:234566 37/99 (37%)
AT5G23535NP_001331693.1 rplX 14..110 CDD:234566 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I2369
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1007373at2759
OrthoFinder 1 1.000 - - FOG0004182
OrthoInspector 1 1.000 - - oto2925
orthoMCL 1 0.900 - - OOG6_101141
Panther 1 1.100 - - LDO PTHR12903
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.