DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL24 and RPL26

DIOPT Version :9

Sequence 1:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_000978.1 Gene:RPL26 / 6154 HGNCID:10327 Length:145 Species:Homo sapiens


Alignment Length:95 Identity:25/95 - (26%)
Similarity:42/95 - (44%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TTNRSWTGQFRQQNMPGTVRRKVLVEP----------IEDWSFFRGDRIEVLVGKDKGKQ-GIVT 105
            |::|| ..:.|..|.|..:|||::..|          :......:.|.::|:.|..||:| |.|.
Human     8 TSDRS-KNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVV 71

  Fly   106 QVIPERNWVIVEGLNWHYRKVGGEKEFPGI 135
            ||..::..:.:|.:  ...|..|.....||
Human    72 QVYRKKYVIYIERV--QREKANGTTVHVGI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL24NP_523476.1 rplX 86..183 CDD:234566 15/51 (29%)
RPL26NP_000978.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/13 (31%)
Ribosomal_L26 8..122 CDD:407140 25/95 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..145
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.