DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL24 and mrpl24

DIOPT Version :9

Sequence 1:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001005120.2 Gene:mrpl24 / 448700 XenbaseID:XB-GENE-992391 Length:216 Species:Xenopus tropicalis


Alignment Length:251 Identity:114/251 - (45%)
Similarity:147/251 - (58%) Gaps:39/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLTQYL--ASKLKNFSNLPKEYIERSKKQVYWQTPKEINYLPRTVERKRFRYTTNRSWTGQFRQ 63
            ||||..|  |:|||    ||.:|                            |:..:|..|...::
 Frog     1 MRLTLLLEMAAKLK----LPHDY----------------------------RFGMSRPSTLAAKR 33

  Fly    64 QNMPGTVRRKVLVEPI--EDWSFFRGDRIEVLVGKDKGKQGIVTQVIPERNWVIVEGLNWHYRKV 126
            :|.||..|.||.|||:  |:|.:||||.:|||.|||.||||.||||:..||||:::|||.|||.|
 Frog    34 RNPPGKRRSKVFVEPVSKEEWQYFRGDTVEVLHGKDAGKQGKVTQVVRARNWVVIDGLNTHYRYV 98

  Fly   127 GGEKEFPGIIIKSEAPLHVTKDIRLVDPSDLQGTDFEWRFTEEGEKVRVSLRSGRIIPIPETNNQ 191
            |..:|:.|..:.||||| :...:.||||:|.:.||.|||:||||::||||:|||||||.|..  |
 Frog    99 GRTEEYRGTYVASEAPL-LLNQVSLVDPTDRKPTDIEWRYTEEGDRVRVSVRSGRIIPKPVL--Q 160

  Fly   192 THDYKTPNAYIEREKDTPGAVVGEITFQPKLSTFEMDIMEEMGIKEERTPVKSYWY 247
            ..|...|..:.:..|||......|.|:.|.|.||:.:|||:|||:|.|...|||||
 Frog   161 RRDGIIPEQWKDGPKDTSVEDALERTYVPSLKTFQEEIMEKMGIEENRQQRKSYWY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL24NP_523476.1 rplX 86..183 CDD:234566 58/96 (60%)
mrpl24NP_001005120.2 rplX 58..154 CDD:234566 58/96 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9828
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12241
Inparanoid 1 1.050 195 1.000 Inparanoid score I3719
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1007373at2759
OrthoFinder 1 1.000 - - FOG0004182
OrthoInspector 1 1.000 - - oto104983
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5232
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.