DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL24 and mrpl24

DIOPT Version :9

Sequence 1:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001007638.1 Gene:mrpl24 / 295224 RGDID:1359289 Length:216 Species:Rattus norvegicus


Alignment Length:201 Identity:99/201 - (49%)
Similarity:129/201 - (64%) Gaps:5/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FRYTTNRSWTGQFRQQNMPGTVRRKVLVEPI--EDWSFFRGDRIEVLVGKDKGKQGIVTQVIPER 111
            :||..:|..:...:::|.|.:.||.|:||||  |||..|.||.:|:|.|||.||||.|.||:.:|
  Rat    19 YRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQR 83

  Fly   112 NWVIVEGLNWHYRKVGGEKEFPGIIIKSEAPLHVTKDIRLVDPSDLQGTDFEWRFTEEGEKVRVS 176
            |||::||||.|||.:|..|:..|.:|.||||| :...::||||.|.:.|:.:|||||.||:||||
  Rat    84 NWVVLEGLNTHYRYIGRTKDHRGTMIPSEAPL-LHHQVKLVDPVDRKPTEIQWRFTEAGERVRVS 147

  Fly   177 LRSGRIIPIPETNNQTHDYKTPNAYIEREKDTPGAVVGEITFQPKLSTFEMDIMEEMGIKEERTP 241
            .|||||||.||....  |...|..:.:..|||......|.|:.|:|.|.|.|:||.|||:|.|..
  Rat   148 TRSGRIIPKPEFPRA--DGIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRF 210

  Fly   242 VKSYWY 247
            .|.|||
  Rat   211 KKIYWY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL24NP_523476.1 rplX 86..183 CDD:234566 55/96 (57%)
mrpl24NP_001007638.1 KOW 59..154 CDD:294253 55/95 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343076
Domainoid 1 1.000 61 1.000 Domainoid score I10271
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12241
Inparanoid 1 1.050 181 1.000 Inparanoid score I3883
OMA 1 1.010 - - QHG52435
OrthoDB 1 1.010 - - D1007373at2759
OrthoFinder 1 1.000 - - FOG0004182
OrthoInspector 1 1.000 - - oto98289
orthoMCL 1 0.900 - - OOG6_101141
Panther 1 1.100 - - LDO PTHR12903
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5232
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.