DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL24 and mrpl40

DIOPT Version :9

Sequence 1:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_593870.1 Gene:mrpl40 / 2543447 PomBaseID:SPAC4F8.02c Length:279 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:47/174 - (27%)
Similarity:70/174 - (40%) Gaps:54/174 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 WSFFRGDRIEVLVGKDKGKQGIVTQVIPERNWVIVEGLNWHYRKV--------GGEKEFPGIIIK 138
            |..|:||.:.|..|..|||.|.|.:.....|.:.:||:|....||        ..:.:.|.|.|.
pombe    66 WHIFKGDYVYVHQGPLKGKWGRVVETNKYTNGITIEGVNVRSVKVPIFLLRNKPEDNQDPVIDIA 130

  Fly   139 SEAPLHVTKDIRLVDPSDLQGTDFEWRFTEEGEKVRV----------SLRSGRII---------- 183
            .|  :|.. ::||:..:.          |:.||.|.:          :|||  ||          
pombe   131 HE--VHYA-NVRLLAHAK----------TDAGEPVLIPVKLKKHSSTNLRS--IIRPNIEGVQIH 180

  Fly   184 ----PIPETNNQTHDYKTPNAYIEREKDTPGAVVGEITFQPKLS 223
                |.|:|.::..|   |    |.:.||...||.::|:.|.||
pombe   181 TIHLPRPKTEDKPKD---P----EGKLDTKNPVVSKVTWSPSLS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL24NP_523476.1 rplX 86..183 CDD:234566 29/114 (25%)
mrpl40NP_593870.1 RplX 64..>152 CDD:223276 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004182
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101141
Panther 1 1.100 - - LDO PTHR12903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.