DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL24 and Rpl26

DIOPT Version :10

Sequence 1:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_033106.1 Gene:Rpl26 / 19941 MGIID:106022 Length:145 Species:Mus musculus


Alignment Length:95 Identity:25/95 - (26%)
Similarity:42/95 - (44%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TTNRSWTGQFRQQNMPGTVRRKVLVEP----------IEDWSFFRGDRIEVLVGKDKGKQ-GIVT 105
            |::|| ..:.|..|.|..:|||::..|          :......:.|.::|:.|..||:| |.|.
Mouse     8 TSDRS-KNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVV 71

  Fly   106 QVIPERNWVIVEGLNWHYRKVGGEKEFPGI 135
            ||..::..:.:|.:  ...|..|.....||
Mouse    72 QVYRKKYVIYIERV--QREKANGTTVHVGI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL24NP_523476.1 RplX 86..183 CDD:439968 15/51 (29%)
Rpl26NP_033106.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/13 (31%)
Ribosomal_L26 8..122 CDD:465307 25/95 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..145
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.