DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgs1 and Muc68D

DIOPT Version :10

Sequence 1:NP_523475.3 Gene:Sgs1 / 33701 FlyBaseID:FBgn0003372 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:47 Identity:9/47 - (19%)
Similarity:24/47 - (51%) Gaps:14/47 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RMGIHDE-----KDRGDILREIIKQR---------LKTDIMEIRDME 101
            :.|:.:|     :|:..:::|:::.|         |:|.:..::.||
  Fly   158 KFGLEEEVERLKRDKNVLMQELVRLRQQQQSTDNQLQTMVQRLQGME 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgs1NP_523475.3 None
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
dermokine <1084..>1257 CDD:455732
CBM_14 1314..1366 CDD:426342
CBM_14 1388..1440 CDD:426342
ChtBD2 1459..1505 CDD:214696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.