DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoe2 and CG7309

DIOPT Version :9

Sequence 1:NP_608878.1 Gene:hoe2 / 33700 FlyBaseID:FBgn0031649 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_609468.4 Gene:CG7309 / 34509 FlyBaseID:FBgn0032314 Length:528 Species:Drosophila melanogaster


Alignment Length:289 Identity:59/289 - (20%)
Similarity:102/289 - (35%) Gaps:114/289 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 LLLQSAGALLFVIVCFFIQSVPHWRTLPLGWVALLGVILLLIILNRDDMEHLMHRIEWTTLLFFA 694
            |.|.:.||..|:.:.|          :|:..:|....|.:..               :|.|:||.
  Fly    67 LNLMARGAAAFIYMVF----------IPVAGIASSKEISVSY---------------YTDLIFFV 106

  Fly   695 AMFVMMECVERLGIFACISELTEH----VILSVGKSHRLAMAIFMILWMSALASSILDSIPVAAI 755
            ...:.|      ||....|:|::.    ||..||.|.:. :.||:.: .:|:.|.:::....||.
  Fly   107 YSAIFM------GIMMDSSKLSDRLAFIVISLVGGSLKF-LQIFLTI-AAAIVSILVNPTISAAF 163

  Fly   756 MVKLVTSLVA--------------KP----SLGLPLQPLV-------WALTLGASM----GGNGT 791
            .:|:..:::.              ||    |...|.:|::       :|.:|.||:    ..||.
  Fly   164 WMKVSQAVMVEYDNGGLIKLNSEEKPYEIGSKPYPTRPVIGIYLTCCYAASLAASLSPIVNPNGV 228

  Fly   792 L---YGASANVIAAG---------------------------------IAEQHGYKLSFTRYLRT 820
            :   :|.|..|:..|                                 :||..|.|..|.:....
  Fly   229 ISDGFGGSLTVLEIGMLMAGPALMGLVVMIFWLQVLFLGLLGGSVKRDLAEMAGAKAGFKQTASE 293

  Fly   821 ---------VFPMM-LGQITLMTVYLLVA 839
                     ::|:: |..|.||  :||||
  Fly   294 RKQALGPWGIYPILALSLILLM--FLLVA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoe2NP_608878.1 ArsB 343..837 CDD:223983 55/285 (19%)
P_permease 350..837 CDD:238536 55/285 (19%)
CG7309NP_609468.4 CitT 31..523 CDD:223547 59/289 (20%)
ArsB_NhaD_permease 76..523 CDD:304373 55/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.