Sequence 1: | NP_608878.1 | Gene: | hoe2 / 33700 | FlyBaseID: | FBgn0031649 | Length: | 846 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609468.4 | Gene: | CG7309 / 34509 | FlyBaseID: | FBgn0032314 | Length: | 528 | Species: | Drosophila melanogaster |
Alignment Length: | 289 | Identity: | 59/289 - (20%) |
---|---|---|---|
Similarity: | 102/289 - (35%) | Gaps: | 114/289 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 630 LLLQSAGALLFVIVCFFIQSVPHWRTLPLGWVALLGVILLLIILNRDDMEHLMHRIEWTTLLFFA 694
Fly 695 AMFVMMECVERLGIFACISELTEH----VILSVGKSHRLAMAIFMILWMSALASSILDSIPVAAI 755
Fly 756 MVKLVTSLVA--------------KP----SLGLPLQPLV-------WALTLGASM----GGNGT 791
Fly 792 L---YGASANVIAAG---------------------------------IAEQHGYKLSFTRYLRT 820
Fly 821 ---------VFPMM-LGQITLMTVYLLVA 839 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hoe2 | NP_608878.1 | ArsB | 343..837 | CDD:223983 | 55/285 (19%) |
P_permease | 350..837 | CDD:238536 | 55/285 (19%) | ||
CG7309 | NP_609468.4 | CitT | 31..523 | CDD:223547 | 59/289 (20%) |
ArsB_NhaD_permease | 76..523 | CDD:304373 | 55/280 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45448711 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |