DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and YCT1

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_013045.1 Gene:YCT1 / 850671 SGDID:S000003978 Length:531 Species:Saccharomyces cerevisiae


Alignment Length:426 Identity:83/426 - (19%)
Similarity:152/426 - (35%) Gaps:104/426 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NLTIAIV---DMVRPNVT-------------------SAVNATLVGNSTAANSTASPDGVDVYEE 81
            ::|:|.:   |...|.:|                   ||:|..|..:    .:|.|.|.:..:.|
Yeast    27 DVTLAFMEENDAAVPEITPEQEKKLKRKLFLTIFTFVSAINLLLYMD----KATLSYDSILGFFE 87

  Fly    82 RFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIG-GRRVFGHSMLWASLLTLITPLAAHINYVV 145
            .........|.|...|:.|:.:.:.||..||:.:. |:.:.|....|..|:.|   .....|:..
Yeast    88 DTGLTQNTYNTVNTLFYVGFAIGQFPGQYLAQKLPLGKFLGGLLATWTILIFL---SCTAYNFSG 149

  Fly   146 LIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMASSLGAAITMPICGYLI------SV 204
            ::.:|..||.......|.:.....::....||:.......|:.:|:.|......|.:      |:
Yeast   150 VVALRFFLGLTESVVIPILITTMGMFFDASERAAAQPFFFAACMGSPIPTGFIAYGVLHITNPSI 214

  Fly   205 AGWASVFYLTGAVGLLWS---LAWFTFVYETPATHPRISAEER----REIEEAIGTTTSKKRPSH 262
            :.|.....:.|.:..:.:   :.||.   ..||.....|.:||    |.::.:.|::..:|....
Yeast   215 SLWKIFTIIIGGLTFIMTVVVILWFP---NNPADVKFFSIQERVWIIRRVQASTGSSIEQKVFKK 276

  Fly   263 VPWGQLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNGLFSSL---PYLGKYVM 324
            ..:.:.:.....|         :||.|.::.||..      :...:||.||..:   ..||..::
Yeast   277 SQFREAMKDYITW---------LFGLFFLLQQLAN------NLPYQQNLLFEGMGGVDALGSTLV 326

  Fly   325 AVAS-------SYLADYLRKKGTLSTTATRKLFTTFALV----------------IPGLLMIVQV 366
            :||.       :::|..:..|....:..|...:|..|||                :..:.|..|:
Yeast   327 SVAGAGFAVVCAFIATLMLAKWKNISALTAIFWTLPALVGSIAAAALPWDNKIGILANICMAGQI 391

  Fly   367 F---------------LGYDATWSVTIFSLALFAHG 387
            |               .||  |..:|..|::|||.|
Yeast   392 FGIPFIIALSWASSSASGY--TKKLTRSSVSLFAMG 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 83/426 (19%)
MFS 83..461 CDD:119392 70/360 (19%)
YCT1NP_013045.1 MFS_FEN2_like 54..462 CDD:340885 78/399 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.