DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and MFS18

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster


Alignment Length:467 Identity:114/467 - (24%)
Similarity:199/467 - (42%) Gaps:84/467 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LNLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDGVDVYEERFPWD 86
            :.|:|  |..:.|:.|..:.:.:     |.|.||..                           |.
  Fly    31 ITLIT--GTCMLYSTRTTMPLLV-----PAVASAQK---------------------------WS 61

  Fly    87 SYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLITP----LAAHI-NYVV- 145
            ...:..||..|||||.||::.||..::..||:||...:.:..||:|.:.|    .|..| :|.: 
  Fly    62 KTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAGSIKSYAIP 126

  Fly   146 -LIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMA-SSLGAAITMPICGYLISVAGWA 208
             ::.:|::.|.:.|..:|::..:.:..:.|.|||.|...:.| |:||..:|..:..:|:...||:
  Fly   127 FIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDYFGWS 191

  Fly   209 SVFYLTGAVGLLWSLA--WFTFVYE-----TPATHPRISAEERREIEEAIGTTTSKKRPSHVPWG 266
            .||.:.|.:|:.|:|.  ::....|     ..||..|:.|.:            |....|.|||.
  Fly   192 YVFRVIGLMGIAWALVLRYYAMAGERNRIINIATPSRLCANK------------SPAETSAVPWL 244

  Fly   267 QLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILH--FDIKQNGLFSSLPYLGKYVMAVASS 329
            :.....:.||.::.|...:..||.:::.|||:    .|  |...:..:.:.:|:|......:.:.
  Fly   245 RYFRRLSFWACVLTHACEMNCFFVLLSWLPTY----FHDGFPHAKGWVVNMIPWLALPPCTLFAK 305

  Fly   330 YLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDATWSVTIFSLAL------FAHGA 388
            ||...|..: ...||..||:..:.......|.:.|   :...:.:...:..:.:      |.:.|
  Fly   306 YLTTRLLAR-EWHTTTVRKVIQSCCFAAQNLALFV---MSRTSDFHTALICMTIIIGGTGFHNNA 366

  Fly   389 VTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYKDQSFHSWQIVFWILAATYIS 453
            ||.    |..|:||...|::|||.||:.:..|||...:.|.:....|   ||.:||...|...:.
  Fly   367 VTV----NPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILELTQ---SWPMVFSAAAGINLV 424

  Fly   454 AAVVFAILGSGE 465
            ..::|.:.||.|
  Fly   425 GWIIFIVFGSAE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 114/467 (24%)
MFS 83..461 CDD:119392 102/400 (26%)
MFS18NP_608835.1 MFS 30..432 CDD:119392 111/461 (24%)
MFS_1 32..397 CDD:284993 102/422 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.