DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and SPAC11D3.18c

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001342807.1 Gene:SPAC11D3.18c / 2543005 PomBaseID:SPAC11D3.18c Length:498 Species:Schizosaccharomyces pombe


Alignment Length:482 Identity:101/482 - (20%)
Similarity:178/482 - (36%) Gaps:130/482 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVRNFLSCRQVLNLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDG 75
            :|...|..:..|.:..::||:        ..:|.:|  |.|         :||:..|..|   :.
pombe    48 KVEKKLLLKMDLVISPIIGFL--------YLMAFLD--RSN---------IGNAAVAGMT---EA 90

  Fly    76 VDVYEERFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGH-SMLWASLLTLITPLAA 139
            :.:|.||.       |..:..|:..|||.|.|...|.:.|...|:... |..| |:..|.:...:
pombe    91 LSLYGERL-------NVAVSIFYVLYILVETPSVVLVKRIKASRMLAFISFAW-SMTVLFSGFMS 147

  Fly   140 HINYVVLIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMASS-LGAAITMPICGYLIS 203
              :|..||..|::||.:.|..:||::..........|:.:.:|.:.||: |..|.     |.|.:
pombe   148 --SYGGLIATRLILGLLEGCLFPALNLYLTTHYTRKEQCQRLSYLFASAGLAGAF-----GGLFA 205

  Fly   204 VA----------GWASVFYLTGAVGL------LWSL------AWFTFVYETPATHPRISAEERRE 246
            .|          ||..::.:.|.|..      |::|      |||            ::.|||  
pombe   206 YALEQVHAGNKEGWQWIYIVEGLVSFIGVPLCLFALPDKMENAWF------------LTREER-- 256

  Fly   247 IEEAIGTTTSKKR---PSHVPWGQL---LCSPAVWAII---ICHGLAVFGFFTVVNQLPTFMSKI 302
             |.||.......|   ..|..|.::   ...|.|:...   .|..:.::||.:.   ||..:..:
pombe   257 -EVAIIRRDINARYHGEQHFEWSEVRKAFKDPKVYVSATSQFCADMVLYGFSSF---LPVIIKGL 317

  Fly   303 LHFDIKQNGLFSSLPYLGKYVMAVASSYLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQV- 366
            ....::.|  :.::|.   |:..|.|.....:|..:     |..|.::...|..:..:..|:.: 
pombe   318 GFVGLQTN--YMTIPV---YIAGVISFLFVAWLSDR-----TQLRAVYLISASTVVAVGYIIMLA 372

  Fly   367 ----FLGYDATWSVTIFSLALFAHGAVTAGYLGNGLDIAPNF-GGTIFGLANTLSSFGGF----- 421
                ...|.||:   |.::..:....:..|:|.|  ::|.:: ..|..|:..||::..|.     
pombe   373 SDSNAAKYTATY---IIAIGCYIGPGLNLGWLNN--NVAGHYKRATAIGIQQTLANSSGIVAGQI 432

  Fly   422 ----------------LSTSMVGALTY 432
                            |...:||.|.|
pombe   433 YRSKNAPKYILGNAFTLGCVIVGGLAY 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 99/474 (21%)
MFS 83..461 CDD:119392 85/410 (21%)
SPAC11D3.18cNP_001342807.1 UhpC 68..461 CDD:332119 96/462 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.