DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and SPAC1B3.15c

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_594800.1 Gene:SPAC1B3.15c / 2542116 PomBaseID:SPAC1B3.15c Length:628 Species:Schizosaccharomyces pombe


Alignment Length:503 Identity:105/503 - (20%)
Similarity:170/503 - (33%) Gaps:132/503 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNTEKGGLQRVRNFLSCRQVLNLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAVNATLVGNSTA 66
            |:.||..|.|:|..|.                  ||:...:.|...:..:||.:::.:|..|...
pombe   139 SSEEKKILSRIRRKLD------------------LRIITCLWITYFLSRSVTYSISLSLTMNKHQ 185

  Fly    67 ANS---TASPDGVDVYEERFPWDSYQTNFV-LGCFFWGYILTELPGGRLAELIGGRRVFGHSMLW 127
            .:|   |.|  |:          :|.|..| .|..:...|:.:||...|......|       ||
pombe   186 GHSLLQTVS--GL----------NYHTLSVGTGLSYVSLIIFDLPSNLLMTRADPR-------LW 231

  Fly   128 ASLLTLITPLAAHINYVV---------LIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSN 183
            .|.:.:.|.:....:.|:         .|.:|...|..:...||..    |.:.....|.:.:..
pombe   232 LSRIQVTTGIIGACHAVLGTKGSSASGFIALRFFNGLAIAGMWPGF----AFYTSRFYRDQHLGK 292

  Fly   184 MMASSLGAAITMPICGYLISVAGWASVFYLTGAVG-----LLWSLAWFTFVYETPATHPRISAEE 243
            .:.....||....:...|:| |.:..:..|.|..|     |:|.:..||.....|...|.|...:
pombe   293 RIGWYYTAAQISSVATSLLS-AAFQKMDGLHGLYGYQWMFLIWGVVAFTQGLFLPRWLPCIKHNQ 356

  Fly   244 RRE----------------IEEAIGTTTSKKRPSHVPWGQLLCSPAVWAIIICHGLA-------- 284
            ..|                ..|..|.|..::....:...::....: |.:.   .||        
pombe   357 HNEKWISWIRIPKFLGFLKASENTGLTPEEEEVHAIYMAEMQVGKS-WTLT---DLADAFLDVRL 417

  Fly   285 ---VFGFFTVV---NQLPTFMSKILHFDIKQNGLFSSLP--------YLGKYVMAVASSYLADYL 335
               :|.||.||   |.|..:.|.|:. :|.:|  |||:.        ::...:..:....|.|..
pombe   418 WPPIFMFFGVVGISNGLVNYSSLIIS-EINEN--FSSVTVSLLVAPIWVFDAIAILTVLPLHDRF 479

  Fly   336 RKK-----GTLSTTATRKLFTTFALVIPGL---LMIVQVFLGYDATWSVTIFSLALF-AHGAVTA 391
            .||     |:........|.|||...:.|.   |:|:...||......:|..|.|:. :||.|  
pombe   480 HKKMLFFVGSCLFVLAGLLITTFVSNVWGRYVGLLILGFGLGPTVPIIMTWVSSAMGPSHGDV-- 542

  Fly   392 GYLGNGLDIAPNFGGTIFGLA--NTLSSFGGFLSTSMVGALTYKDQSF 437
                          |...|||  :.|.:.|..::||.:.:....|.:|
pombe   543 --------------GVAAGLAIVSGLGNLGSVVATSALYSGWKADTTF 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 98/486 (20%)
MFS 83..461 CDD:119392 87/419 (21%)
SPAC1B3.15cNP_594800.1 MFS 158..600 CDD:119392 96/466 (21%)
2A0114 190..600 CDD:273326 90/434 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.