DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and SLC37A4

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001157750.1 Gene:SLC37A4 / 2542 HGNCID:4061 Length:451 Species:Homo sapiens


Alignment Length:437 Identity:92/437 - (21%)
Similarity:156/437 - (35%) Gaps:96/437 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ERFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLITPLAAHINYVV 145
            |..|.|.....|:.......|.:::...|.|::.:..|.:|...:|...|:.:....::.:  .|
Human    40 EEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTV--PV 102

  Fly   146 LIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKF--------MSNMMASSLGAAITMPICGYLI 202
            ...:..:.|...|..||....|...|..|   |:|        .|..:|..||     ||...::
Human   103 FAALWFLNGLAQGLGWPPCGKVLRKWFEP---SQFGTWWAILSTSMNLAGGLG-----PILATIL 159

  Fly   203 SVA-GWASVFYLTGAVGLLWSLAWFTFVYETPATHPRISAEERREIEEAIGTTTSKKRPSHVPWG 266
            :.: .|.|...|:||:.::.|......::..||.               :|.......||....|
Human   160 AQSYSWRSTLALSGALCVVVSFLCLLLIHNEPAD---------------VGLRNLDPMPSEGKKG 209

  Fly   267 ---------QLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNG-------LFSS 315
                     :||.||.:|.:...: |.|||..|.......|      |.|::.|       .:.|
Human   210 SLKEESTLQELLLSPYLWVLSTGY-LVVFGVKTCCTDWGQF------FLIQEKGQSALVGSSYMS 267

  Fly   316 LPYLGKYVMAVASSYLADYLRKKGTLSTTATRK----LFTTFALVIPGLLMIVQVFLGYD----- 371
            ...:|..|.::|:.||:|....|..||.....:    ||....:.:.  :.:.:|.:..|     
Human   268 ALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPRHGLLLFMMAGMTVS--MYLFRVTVTSDSPKDV 330

  Fly   372 ATWSVTIFSLA-----------LFAHGAVTA----------GYLGNGLDIAPNFGGTIFGLANTL 415
            |.|::.:..||           :...|||..          |.:.|. ...||..||...:...:
Human   331 AFWTLALHPLAELTGFTEHELWILVLGAVFGFSSYGPIALFGVIANE-SAPPNLCGTSHAIVGLM 394

  Fly   416 SSFGGFLSTSMVGALTYKDQSFH-SWQIVFWILAATYISAAVVFAIL 461
            ::.||||:     .|.:...:.| ||...||:......::...|.:|
Human   395 ANVGGFLA-----GLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 92/437 (21%)
MFS 83..461 CDD:119392 90/433 (21%)
SLC37A4NP_001157750.1 MFS 14..437 CDD:119392 92/437 (21%)
2A0104 18..419 CDD:273319 88/418 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1.032774 Normalized mean entropy S7088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.