DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and SLC17A8

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_647480.1 Gene:SLC17A8 / 246213 HGNCID:20151 Length:589 Species:Homo sapiens


Alignment Length:488 Identity:156/488 - (31%)
Similarity:254/488 - (52%) Gaps:39/488 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RQVLNLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDG-VDVYEER 82
            |.::.:::.|||.:::.:|.||.:|||:||.                  |||...|| .::...:
Human    75 RYIIAIMSGLGFCISFGIRCNLGVAIVEMVN------------------NSTVYVDGKPEIQTAQ 121

  Fly    83 FPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLITPLAAHINYVVLI 147
            |.||......:.|.||||||:|::|||.::......||||.::...|.|.:..|.||.::|..::
Human   122 FNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVM 186

  Fly   148 VVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMASS-LGAAITMPICGYLISVAGWASVF 211
            .||::.|.:.|.::||.|.:.:.|.||:|||:..:.....| .||.:.||:.|.|:...||:|||
Human   187 CVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVF 251

  Fly   212 YLTGAVGLLWSLAWFTFVYETPATHPRISAEERREIEEAIG-----TTTSKKRPSHVPWGQLLCS 271
            |:.|..|::|.:.|....||.||.||.||.||:..||.:||     .:.||   ...||.:...|
Human   252 YIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSK---FSTPWKRFFTS 313

  Fly   272 PAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNGLFSSLPYLGKYVMAVASSYLADYLR 336
            ..|:|||:.:....:.|:.::...|.:..::..|.|.:.||.|::|::...::......||||||
Human   314 LPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLR 378

  Fly   337 KKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDATWSVTI--FSLALFAHGAVTAGYLGNGLD 399
            .:..|:|||.||:.......:...|::|   :|:..|..|.|  ..||:...|...:|:..|.||
Human   379 SRQILTTTAVRKIMNCGGFGMEATLLLV---VGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLD 440

  Fly   400 IAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYKDQSFHSWQIVFWILAATYISAAVVFAILGSG 464
            |||.:...:.|::|.:.:..|.:...:|||:| :.::...||.||.|.|..:.|..:.:.:..||
Human   441 IAPRYASILMGISNGVGTLSGMVCPLIVGAMT-RHKTREEWQNVFLIAALVHYSGVIFYGVFASG 504

  Fly   465 ELQPWNNP----PERVRISDVTQ-EEGVPLKNE 492
            |.|.|.:|    .|:..|.|..: .|.:.|.:|
Human   505 EKQEWADPENLSEEKCGIIDQDELAEEIELNHE 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 151/470 (32%)
MFS 83..461 CDD:119392 127/385 (33%)
SLC17A8NP_647480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..61
2A0114euk 75..513 CDD:129972 149/462 (32%)
MFS 80..502 CDD:119392 143/446 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.