DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and C01B4.8

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_503682.1 Gene:C01B4.8 / 182055 WormBaseID:WBGene00015272 Length:478 Species:Caenorhabditis elegans


Alignment Length:454 Identity:114/454 - (25%)
Similarity:190/454 - (41%) Gaps:68/454 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDGVDVYEERFP----W--DSYQTNFVLGCFF 98
            ||:..:.:::.| :.|.|.|::..|         |..|.|....|    |  ||...:.|.....
 Worm    40 LTLTCLTLLQMN-SLAFNFTVICMS---------DVSDDYHITHPNETHWFEDSNMKSLVFSSMA 94

  Fly    99 WGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLITPLAAHINYVVLIVVRVVLGFMLGASWPA 163
            .|.:|..|....|...:|.|.|.....:::.|.|::.|||...|:..::|||.:.|..:...:..
 Worm    95 VGGLLGLLIAMPLMHRVGVRLVLSICGVFSILGTILFPLAVEWNFFSVLVVRFLQGLGISMVFTV 159

  Fly   164 IHPVAAVWIPPMERSKFMSNM-MASSLGAAITMPICGYLI-SVAGWASVFYLTGAVGLLWSLAWF 226
            :..|...|.|..|...|::.: .|......|.|||.|:|. |..||.|::||.|.|.:::.||::
 Worm   160 LGSVPTAWAPNNESGTFLAVLSCAFQWSNVICMPISGFLCESSWGWRSIYYLFGIVTIVFFLAFY 224

  Fly   227 TFVYETPATHPRISAEERREIEEAIGTTTSKKRPSHVPWGQLLCSPAV---WAIIICHGLAVFGF 288
            .|..::|..|..:|.:|...|.:  ..|.:.|.|  ||:..:...|.|   |...|...|   ||
 Worm   225 FFYTDSPTDHRNVSNKELSLILQ--DKTVTHKEP--VPYLAICKDPCVLVTWMSNIGGNL---GF 282

  Fly   289 FTVVNQLPTFMSKILHFDIKQNGLFSSLPYLGKYVMAVASSYLADYLRKKGTLSTTATRKLFTTF 353
            .|:|...||::.::|:|:::..|..|:||:|    ::.|...:|..|..:  ....:.|..||  
 Worm   283 LTLVLYGPTYLREVLNFEVRGTGFASALPFL----LSAAVKSIAGQLSDR--CDFVSERVRFT-- 339

  Fly   354 ALVIPGLLMIVQVFLGYDATWSVTIFSLALFAHGAVTAGYLGNGLDIA-------------PNFG 405
               |.|::..:.:.:||   ..:...|..|.|..|.|.....:||:|.             .:|.
 Worm   340 ---ICGIVARLGLAIGY---IGMATTSSRLVAQIAFTFSIAVSGLNIMGTVKCLQLRCKQHVHFA 398

  Fly   406 GTIFGLANTLSSFGGFLSTSMVGALTYKDQSFHSWQIVFWILAATYISAAVVFAILGSGELQPW 469
            .::..|...:..||   :..:||.:. .|.:...|...|.|:.......:..|         ||
 Worm   399 VSVIALMAYVIQFG---APILVGIIC-PDNTAEQWGWFFLIVGIIVFVTSAPF---------PW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 114/454 (25%)
MFS 83..461 CDD:119392 102/401 (25%)
C01B4.8NP_503682.1 MFS 56..443 CDD:391944 107/420 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28615
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.