DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and Slc37a4

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001344658.1 Gene:Slc37a4 / 14385 MGIID:1316650 Length:450 Species:Mus musculus


Alignment Length:416 Identity:93/416 - (22%)
Similarity:157/416 - (37%) Gaps:95/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YILTELPGGRLAELIGGRRVFGHSMLWASLLTLITPLAAHINYVVLIVVRVVLGFMLGASWPAIH 165
            |.:::...|.|::.:..|.:|...:|...|:.::...::.::  ....:..:.|...|..||...
Mouse    60 YAISKFVSGVLSDQMSARWLFSSGLLLVGLVNVVFSWSSTVS--AFAALWFLNGLAQGLGWPPCG 122

  Fly   166 PVAAVWIPPMERSKF--------MSNMMASSLGAAITMPICGYLISVA-GWASVFYLTGAVGLLW 221
            .:...|..|   |:|        .|..:|.|||     ||...:::.: .|.|...|:||:.::.
Mouse   123 KILRKWFEP---SQFGTWWAVLSTSMNLAGSLG-----PILATILAQSYSWRSTLALSGALCVVV 179

  Fly   222 SLAWFTFVYETPATHPRISAEERREIEEA--IGTTTSKKRPSHVPWGQLLCSPAVWAIIICHGLA 284
            |......::..||.      ...|.::.|  .|...|.|..|.:.  .||.||.:|.:...: |.
Mouse   180 SFFCLLLIHNEPAD------VGLRNLDPAPSKGKKGSSKEESTLQ--DLLLSPYLWVLSTGY-LV 235

  Fly   285 VFGFFTVVNQLPTFMSKILHFDIKQNG-------LFSSLPYLGKYVMAVASSYLADYLRKKGTLS 342
            |||..|.......|      |.|::.|       .:.|...:|..|.::|:.||:|....|..||
Mouse   236 VFGVKTCCTDWGQF------FLIQERGQSALVGSSYISALEVGGLVGSIAAGYLSDRAMAKAGLS 294

  Fly   343 TTATRKLFTTFALVIPGLLMIV------QVFL---------GYDATWSVTIFSLA---------- 382
            .....:         .|||:::      .:||         ..||.|:..:..||          
Mouse   295 LYGNPR---------HGLLLLMMAGMAASMFLFRVTVTSDSPKDAFWTPALHPLAELTGFTEHEI 350

  Fly   383 -LFAHGAVTA----------GYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYKDQS 436
             :...|||..          |.:.|. ...||..||...:...:::.||||:     .|.:...:
Mouse   351 WILVLGAVFGFSSYGPIALFGVIANE-SAPPNLCGTSHAIVGLMANVGGFLA-----GLPFSTIA 409

  Fly   437 FH-SWQIVFWILAATYISAAVVFAIL 461
            .| ||...||:......::.|||.:|
Mouse   410 KHYSWSTAFWVAEVVCGASTVVFFLL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 93/416 (22%)
MFS 83..461 CDD:119392 92/414 (22%)
Slc37a4NP_001344658.1 MFS_SLC37A4 10..438 CDD:340901 93/416 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1.032774 Normalized mean entropy S7088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.