DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and Slc17a7

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_038966881.1 Gene:Slc17a7 / 116638 RGDID:620101 Length:585 Species:Rattus norvegicus


Alignment Length:481 Identity:158/481 - (32%)
Similarity:255/481 - (53%) Gaps:25/481 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLQRVRNFLSCRQVLNLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAVNATLVG---NSTAANS 69
            ||.|       |.::.:::.|||.:::.:|.||.:|||.||..:.|......:|.   .|.....
  Rat    58 GLPR-------RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQTPYRSVHKQE 115

  Fly    70 TASP-----DGVDVYEERFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWAS 129
            ..:|     .|.|..:.:|.||......:.|.||||||:|::|||.:.:.....||||.:::..|
  Rat   116 AVTPTVGDIQGGDTEKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATS 180

  Fly   130 LLTLITPLAAHINYVVLIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMASS-LGAAI 193
            .|.::.|.||.::|..:|.||::.|.:.|.::||.|.:.:.|.||:|||:..:.....| .||.:
  Rat   181 TLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVV 245

  Fly   194 TMPICGYLISVAGWASVFYLTGAVGLLWSLAWFTFVYETPATHPRISAEERREIEEAIGTTTSKK 258
            .||:.|.|:..:||:||||:.|:.|:.|.|.|....||:||.||.||.|||:.||:|||.:....
  Rat   246 AMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLM 310

  Fly   259 RP---SHVPWGQLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNGLFSSLPYLG 320
            .|   .:.||.:...|..|:|||:.:....:.|:.::...|.:..::..|:|.:.||.|:||:|.
  Rat   311 NPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLV 375

  Fly   321 KYVMAVASSYLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDATWSVTI--FSLAL 383
            ..::......:||:||.:..:|||..|||.......:...|::|   :||..:..|.|  ..||:
  Rat   376 MTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLV---VGYSHSKGVAISFLVLAV 437

  Fly   384 FAHGAVTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYKDQSFHSWQIVFWILA 448
            ...|...:|:..|.|||||.:...:.|::|.:.:..|.:...:|||:| |.::...||.||.|.:
  Rat   438 GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMT-KHKTREEWQYVFLIAS 501

  Fly   449 ATYISAAVVFAILGSGELQPWNNPPE 474
            ..:....:.:.:..|||.|||..|.|
  Rat   502 LVHYGGVIFYGVFASGEKQPWAEPEE 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 155/470 (33%)
MFS 83..461 CDD:119392 129/383 (34%)
Slc17a7XP_038966881.1 MFS_SLC17A6_7_8_VGluT 66..515 CDD:340940 146/452 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.