DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3036 and SLC17A2

DIOPT Version :9

Sequence 1:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001273052.1 Gene:SLC17A2 / 10246 HGNCID:10930 Length:478 Species:Homo sapiens


Alignment Length:484 Identity:146/484 - (30%)
Similarity:233/484 - (48%) Gaps:39/484 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TEKGGLQRVRNFLSCRQVLNLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAV-NATLVGNSTAA 67
            |.||     .:|.|.|..|.|:...........||:|:|||:.||.......: ||:..|....|
Human     7 TRKG-----PDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTEGPVADA 66

  Fly    68 --NSTASPDGVDVYEERFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASL 130
              ||:.|....|.....:.|.......:.....:|.|||.:|.|.||.:.|.:::.|..:|.:||
Human    67 FNNSSISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSL 131

  Fly   131 LTLITPLAAHINYVVLIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNM-MASSLGAAIT 194
            |||.|||||....:::|:||.|.|...|.:|.....:.|.|.||:||||..:.. ..|:.|:.|.
Human   132 LTLFTPLAADFGVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFII 196

  Fly   195 MPICGYLISVAGWASVFYLTGAVGLLWSLAWFTFVYETPATHPRISAEERREIEEAIGTTTSKKR 259
            :.:.|.:.....|..:||:.|:.|.:..|.|||.:|:.|..||.||..|:..|..::.     ::
Human   197 LCVGGLISQALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVREKEHILSSLA-----QQ 256

  Fly   260 PSH----VPWGQLLCSPAVWAIIICHGLAVFGFFT-------VVNQLPTFMSKILHFDIKQNGLF 313
            ||.    ||...::....:|||.:       |||:       ::..|||::|.:||.:|:.:|:.
Human   257 PSSPGRAVPIKAMVTCLPLWAIFL-------GFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVL 314

  Fly   314 SSLPYLGKYVMAVASSYLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDATWSVTI 378
            ||||::......:....|||:|..:..|.....||||::..|::|.:..:...|:.  :::.:||
Human   315 SSLPFIAAASCTILGGQLADFLLSRNLLRLITVRKLFSSLGLLLPSICAVALPFVA--SSYVITI 377

  Fly   379 FSLALF--AHGAVTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYKDQSFHS-W 440
            ..|.|.  ......:|::.|.|||||.:...:.|::.......|.:|::..|.|.  .|.|.| |
Human   378 ILLILIPGTSNLCDSGFIINTLDIAPRYASFLMGISRGFGLIAGIISSTATGFLI--SQDFESGW 440

  Fly   441 QIVFWILAATYISAAVVFAILGSGELQPW 469
            :.||::.||..:...|.:...|..|||.|
Human   441 RNVFFLSAAVNMFGLVFYLTFGQAELQDW 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 141/469 (30%)
MFS 83..461 CDD:119392 117/392 (30%)
SLC17A2NP_001273052.1 2A0114euk 1..477 CDD:129972 146/484 (30%)
MFS 81..461 CDD:119392 117/395 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.