DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15625 and byr2

DIOPT Version :9

Sequence 1:NP_608872.1 Gene:CG15625 / 33694 FlyBaseID:FBgn0031644 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_595714.2 Gene:byr2 / 2540612 PomBaseID:SPBC1D7.05 Length:659 Species:Schizosaccharomyces pombe


Alignment Length:292 Identity:52/292 - (17%)
Similarity:93/292 - (31%) Gaps:98/292 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DIRRWINGYGYPQYMNTFRVNMITGRKLLLLDASALCAMNIKNF----------DHIRHISYGIR 137
            ::..|:...|..:|:..|..|.|.||.|..|....|..:.|:|.          |::|       
pombe     8 EVAEWLKSIGLEKYIEQFSQNNIEGRHLNHLTLPLLKDLGIENTAKGKQFLKQRDYLR------- 65

  Fly   138 MLFHFELTKFSSSISLPDEKPNELYLLFHTQTGVNYDEVRRSDLYRRMQMLRERARNLDHWDLLY 202
                              |.|....|.|....|.......|.| |::...:..:..:|:......
pombe    66 ------------------EFPRPCILRFIACNGQTRAVQSRGD-YQKTLAIALKKFSLEDASKFI 111

  Fly   203 LWLRHEQ------ERKYKELIGMVPRFTMYKCEEAAKPPEEPEDMEPEELMCMTCIPPCDCDWTA 261
            :.:....      |.::|::           |..::.|..:...:.|:|       .||.   :.
pombe   112 VCVSQSSRIKLITEEEFKQI-----------CFNSSSPERDRLIIVPKE-------KPCP---SF 155

  Fly   262 RDLRLPWRLECLPPMLETTMSKWNALQAQCSTCIPPCECRWPPRFYLTGTVIRCLQQRFPEKFCP 326
            .|||..|.:|...|   ..:|..::|..:.|:.:|            |.|..|.::....:.|  
pombe   156 EDLRRSWEIELAQP---AALSSQSSLSPKLSSVLP------------TSTQKRSVRSNNAKPF-- 203

  Fly   327 IFDERYRASP---------------RPSLVER 343
               |.|:..|               :|.|:|:
pombe   204 ---ESYQRPPSELINSRISDFFPDHQPKLLEK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15625NP_608872.1 SAM_Samd14 77..143 CDD:188929 15/69 (22%)
SAM 78..139 CDD:197735 15/65 (23%)
byr2NP_595714.2 PKc_like 393..658 CDD:304357
Pkinase 394..658 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.