DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15625 and Samd15

DIOPT Version :9

Sequence 1:NP_608872.1 Gene:CG15625 / 33694 FlyBaseID:FBgn0031644 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001277217.1 Gene:Samd15 / 238333 MGIID:2685109 Length:620 Species:Mus musculus


Alignment Length:186 Identity:53/186 - (28%)
Similarity:83/186 - (44%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DTKFLHQKVKKKTKIRS-----DMAPTKFQRNEFLKGCPKYDGDDIPIQFRTTPDSLVELSIIVV 68
            |...|..|:|.:..:.|     :...|.::..||||.......:..||...:...:.:..|.::.
Mouse   392 DKLALPAKIKTEFIVGSPRESVESFSTLYETQEFLKDLQTDMNELFPIVDASESQTELRDSTVLP 456

  Fly    69 DKLPL-------PSI---FE---WDDMDIRRWINGYGYPQYMNTFRVNMITGRKLLLLDASALCA 120
            .::.|       ||:   ||   |....:..||:..|:|||...|..|.|.|:||:.::.|.|..
Mouse   457 QEVELLGRKETKPSLTPEFEHLTWSPERVAEWISDLGFPQYKECFTENFINGQKLIHVNCSNLPQ 521

  Fly   121 MNIKNFDHIRHISYGIRMLFHFELTKFSSSISLPDEKPNELYLLFHTQTGVNYDEV 176
            |.|.:|:.::.|||..|:|...|...||.|||||......|:......:||..|.:
Mouse   522 MGITDFEDMKAISYHTRVLLGIEEPLFSRSISLPYRDNKGLFFEQKGHSGVKSDSL 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15625NP_608872.1 SAM_Samd14 77..143 CDD:188929 25/68 (37%)
SAM 78..139 CDD:197735 23/63 (37%)
Samd15NP_001277217.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..394 1/1 (100%)
SAM_Samd14 478..544 CDD:188929 23/65 (35%)
SAM 479..533 CDD:197735 18/53 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11607
eggNOG 1 0.900 - - E1_2CMVG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009897
OrthoInspector 1 1.000 - - otm42537
orthoMCL 1 0.900 - - OOG6_109459
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5600
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.