DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15625 and samd15

DIOPT Version :9

Sequence 1:NP_608872.1 Gene:CG15625 / 33694 FlyBaseID:FBgn0031644 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_002938914.2 Gene:samd15 / 100491118 XenbaseID:XB-GENE-22069104 Length:132 Species:Xenopus tropicalis


Alignment Length:111 Identity:34/111 - (30%)
Similarity:58/111 - (52%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PSIFEWDDMDIRRWINGYGYPQYMNTFRVNMITGRKLLLLDASALCAMNIKNFDHIRHISYGIRM 138
            |....|...::..|:...|:|||...|..|.|:||||:.::.|.|..:.:.:|.|::.||..||.
 Frog    19 PDCLRWSCREVGGWLRFKGFPQYEACFTQNYISGRKLIHVNCSTLPQIGVTDFQHMKEISRLIRD 83

  Fly   139 LFHFELTKFSSSISLPDEKPNELYLLFHTQTGVNYDEVRRSDLYRR 184
            |.:.....::.|:|||......|:|...:|||:|.:.:..|...::
 Frog    84 LLNITEPLWTRSVSLPHRDNMGLFLEKKSQTGLNTESLTYSQFIKQ 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15625NP_608872.1 SAM_Samd14 77..143 CDD:188929 22/65 (34%)
SAM 78..139 CDD:197735 21/60 (35%)
samd15XP_002938914.2 SAM_superfamily 22..87 CDD:387673 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10499
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009897
OrthoInspector 1 1.000 - - otm47637
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.