DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3008 and RIOK2

DIOPT Version :9

Sequence 1:NP_608871.1 Gene:CG3008 / 33693 FlyBaseID:FBgn0031643 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_651365.1 Gene:RIOK2 / 43046 FlyBaseID:FBgn0039306 Length:538 Species:Drosophila melanogaster


Alignment Length:377 Identity:81/377 - (21%)
Similarity:146/377 - (38%) Gaps:71/377 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 NKVFNQLRAHS----RRGRSDKHEKVATAEMGLDAGTRLLLYKLINNQILEQINGIISTGKEAVI 290
            :|:..:|..|.    .||:  |::.......|.|   .|.|..|.....:......|..|||:.|
  Fly    50 HKLLKELCKHKLLAYERGK--KYDGYRLTNTGYD---YLALKSLTLRGSVSSFGNQIGIGKESNI 109

  Fly   291 LHANSDANYTGSNEHGHQSGVLVPPQLLPRECAIKIFKTTLNEFKQRDRYIKDDYRFKDRFSKQN 355
                    |..::|.|  :.:.:....|.|.|.             |:...|.||.  .|..|.:
  Fly   110 --------YVVADEEG--TPICLKLHRLGRTCF-------------RNVKAKRDYH--GRRHKAS 149

  Fly   356 HRVIINMWAEKEMHNLMRMQAIGLNVPDVVVLKKHVLVMRFIGDNHNAAPKLKDARLSDAELSCA 420
            ...:..:.|.:|...:..:...|..||..:...:|.::|..:    ...|..:...|.||..  .
  Fly   150 WLYLSRISATREFAYMSALYDRGFPVPKPIDFNRHCVLMDLV----KGWPMTQVHELLDAPQ--V 208

  Fly   421 YEEIVAAMHKLYNEAKLVHADMSEYNILWFE-GKCWFIDVAQSVEPKHPSALEFLMRDCGNIVNF 484
            |::::..:.:|.|.. ::|.|.:|:|::..: ||...||..|.:...|.:|..|..||...:...
  Fly   209 YDDLMNLIVRLGNSG-VIHGDFNEFNLMVTDAGKPILIDFPQMMSTSHENAEFFFERDVNCVREM 272

  Fly   485 FERR-GLPNIYTKEQLFEFI-----TGLNSEVHTAA-----QLEQ-IHTRGASISQATAPNQEEC 537
            |.|: |    |..|...:|.     ..|::|||...     ::|| :......:.||   ::|:.
  Fly   273 FRRKFG----YESEDYPKFSDLVREDDLDAEVHCTGYGFTKEMEQDLLEEYGMVDQA---DEEDE 330

  Fly   538 PDELKPLEYPFELAWEKSQQDRAAQKALQQAQDNNDNK---TDTDKDQETDD 586
            .::|:..|.|..|.       .||...:.:.:...:|:   ::....|::||
  Fly   331 GEDLEEEEEPPTLV-------TAASVEIDECRRQVENEVIYSEAKPTQKSDD 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3008NP_608871.1 RIO1 242..505 CDD:224632 59/269 (22%)
RIO3_euk 278..488 CDD:270697 46/210 (22%)
RIOK2NP_651365.1 RIO2 3..282 CDD:223554 60/272 (22%)
Rio2_N 9..91 CDD:286310 11/45 (24%)
RIO2_C 94..276 CDD:270695 46/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.