DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CMR3

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_015338.1 Gene:CMR3 / 856123 SGDID:S000006217 Length:317 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:59/256 - (23%)
Similarity:95/256 - (37%) Gaps:82/256 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 HHHQQDQDLAGDQVALKVPPLTVKL-----NKNANGGAIVSHP--QV--------IIKE--EPLS 319
            |:..:::....:...:.:||::..|     |...|..:.|..|  ||        |:.|  .|:|
Yeast    57 HNSYKNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPIS 121

  Fly   320 LSDSGDVVNSVPVYAIQANPGVP----------APASSGVLVGTQTVP----------------- 357
            ::.:.|   ..|:|..::...:|          ||....|:|.|...|                 
Yeast   122 MNATSD---QYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMVPTVYKPLTPYDKEPITIASEPNF 183

  Fly   358 -----ADLAHKIRHKCPDCPKTFKTP---GTLAMHRKIHTGEADATP------------------ 396
                 |...:.....|.|.||:  .|   |.|...::...|...:.|                  
Yeast   184 TAISMASHPNAALELCHDRPKS--VPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSDWKTDTR 246

  Fly   397 ----KERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGY--CEKSFSVKDYLTKHIRTH 451
                |.|. .|..|||..::.:|||.|..||||:.||.|.:  |.|||:||..:.:|:::|
Yeast   247 ISSTKLRK-QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 34/113 (30%)
C2H2 Zn finger 368..388 CDD:275368 7/22 (32%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 8/21 (38%)
zf-H2C2_2 443..468 CDD:316026 2/9 (22%)
C2H2 Zn finger 459..480 CDD:275368
CMR3NP_015338.1 COG5048 17..316 CDD:227381 59/256 (23%)
C2H2 Zn finger 256..276 CDD:275370 8/19 (42%)
C2H2 Zn finger 284..306 CDD:275370 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.