DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CRZ1

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_014371.1 Gene:CRZ1 / 855704 SGDID:S000004972 Length:678 Species:Saccharomyces cerevisiae


Alignment Length:118 Identity:40/118 - (33%)
Similarity:56/118 - (47%) Gaps:22/118 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 PADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTR 421
            ||:.|      |..|.|.|..|..|..|.:.||       .|||:.||.|||:|.:.:..|:|..
Yeast   566 PANFA------CDVCGKKFTRPYNLKSHLRTHT-------NERPFICSICGKAFARQHDRKRHED 617

  Fly   422 IHTGEKPFHCG---------YCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKR 465
            :|||:|.:.||         .|.|.|:..|.|.:|.:|.:|.:..|..|.:.|
Yeast   618 LHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRRCITPLYEEAR 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 37/109 (34%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 8/28 (29%)
zf-H2C2_2 443..468 CDD:316026 7/23 (30%)
C2H2 Zn finger 459..480 CDD:275368 2/7 (29%)
CRZ1NP_014371.1 COG5048 139..617 CDD:227381 23/63 (37%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 599..619 CDD:275368 8/19 (42%)
C2H2 Zn finger 627..655 CDD:275368 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.