DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and SCRT2

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_149120.1 Gene:SCRT2 / 85508 HGNCID:15952 Length:307 Species:Homo sapiens


Alignment Length:172 Identity:54/172 - (31%)
Similarity:76/172 - (44%) Gaps:40/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 RHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERP----------------------YTCSYCG 407
            ||.|.:|.||:.|...|:.|::.|........::.|                      :.|..||
Human   154 RHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHLLTHNLRHKCGVCG 218

  Fly   408 KSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSAL 472
            |:|::...|:.|.|.|||||||.|.:|.|:|:.:..|..|::||:..|.|.|..|||.|..:|.|
Human   219 KAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYL 283

  Fly   473 TVHTTKLHPLXGRPGGGRQLPVPAPAAPPPPTHPPNPSGPGA 514
            ..|..               ...|.||.||   ||.|:||.:
Human   284 HKHCE---------------AACAKAAEPP---PPTPAGPAS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 41/128 (32%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 443..468 CDD:316026 11/24 (46%)
C2H2 Zn finger 459..480 CDD:275368 8/20 (40%)
SCRT2NP_149120.1 SNAG domain. /evidence=ECO:0000250 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..148
C2H2 Zn finger 157..177 CDD:275368 7/19 (37%)
COG5048 <210..>277 CDD:227381 29/66 (44%)
C2H2 Zn finger 214..234 CDD:275368 8/19 (42%)
zf-H2C2_2 227..250 CDD:290200 13/22 (59%)
C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
zf-H2C2_2 254..278 CDD:290200 10/23 (43%)
C2H2 Zn finger 270..286 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.