| Sequence 1: | NP_001350854.1 | Gene: | Cf2 / 33692 | FlyBaseID: | FBgn0000286 | Length: | 537 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_112599.2 | Gene: | SCRT1 / 83482 | HGNCID: | 15950 | Length: | 348 | Species: | Homo sapiens |
| Alignment Length: | 196 | Identity: | 56/196 - (28%) |
|---|---|---|---|
| Similarity: | 81/196 - (41%) | Gaps: | 31/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 334 AIQANPGVPAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKE 398
Fly 399 RP----------------------YTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVK 441
Fly 442 DYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPLXGRPGGGRQLPVPAPAAPPPPTHP 506
Fly 507 P 507 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cf2 | NP_001350854.1 | COG5048 | <366..>473 | CDD:227381 | 39/128 (30%) |
| C2H2 Zn finger | 368..388 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 403..423 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 431..451 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 443..468 | CDD:316026 | 9/24 (38%) | ||
| C2H2 Zn finger | 459..480 | CDD:275368 | 7/20 (35%) | ||
| SCRT1 | NP_112599.2 | SNAG domain. /evidence=ECO:0000250 | 1..20 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 129..189 | 4/29 (14%) | |||
| C2H2 Zn finger | 224..244 | CDD:275368 | 1/19 (5%) | ||
| COG5048 | <245..>313 | CDD:227381 | 27/67 (40%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 306..322 | CDD:275368 | 6/15 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||