DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and gfi1ab

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_958495.1 Gene:gfi1ab / 798697 ZFINID:ZDB-GENE-040116-8 Length:396 Species:Danio rerio


Alignment Length:149 Identity:56/149 - (37%)
Similarity:69/149 - (46%) Gaps:25/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 GTQTVPADLA------------HKIRHK------CPDCPKTFKTPGTLAMHRKIHTGEADATPKE 398
            ||:....|:.            |:..|.      |..|.|:||...||:.|..||:       ..
Zfish   254 GTRPFACDICGKTFGHAVSLEQHRAVHSQERSFDCKICGKSFKRSSTLSTHLLIHS-------DT 311

  Fly   399 RPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCD 463
            |||.|.||||.|.|.:.:|:||.|||||||..|..|.|:||....|..|.|.|||.||:.|..|.
Zfish   312 RPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCG 376

  Fly   464 KRFTQRSALTVHTTKLHPL 482
            |.|.::..|..|....|.|
Zfish   377 KGFQRKVDLRRHKETQHGL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 48/112 (43%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
C2H2 Zn finger 403..423 CDD:275368 10/19 (53%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 12/24 (50%)
C2H2 Zn finger 459..480 CDD:275368 6/20 (30%)
gfi1abNP_958495.1 C2H2 Zn finger 231..252 CDD:275368
C2H2 Zn finger 260..280 CDD:275368 2/19 (11%)
zf-H2C2_2 272..297 CDD:290200 6/24 (25%)
C2H2 Zn finger 288..308 CDD:275368 8/19 (42%)
COG5048 296..>365 CDD:227381 34/75 (45%)
C2H2 Zn finger 316..336 CDD:275368 10/19 (53%)
zf-H2C2_2 328..353 CDD:290200 14/24 (58%)
C2H2 Zn finger 344..364 CDD:275368 8/19 (42%)
C2H2 Zn finger 372..391 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.