DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Zfp507

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_808407.2 Gene:Zfp507 / 668501 MGIID:1916378 Length:941 Species:Mus musculus


Alignment Length:684 Identity:123/684 - (17%)
Similarity:198/684 - (28%) Gaps:252/684 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QRLPRPEDQSPAPPP----PPPSSATTSTAAPATPTH--QVATVIANMDTLKTAFLPNLS--MDP 67
            ::.|||.:.:.:...    ..|:.||.|.||....|.  |.::.:|:.|....::..:|.  :.|
Mouse    68 KKRPRPSETANSLEKLENCEIPAKATESPAAGVRKTEMSQASSTLASNDGKAMSYQCSLCKFLSP 132

  Fly    68 NV-----HVSPH--------YCPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQ 119
            :.     ||..|        .|..||......|.:..|:...|..:.::|...:....|..:.:.
Mouse   133 SFSVLKEHVKQHGQQHDVMLMCSECHATSRSQQELEAHVVSEHENSASSQARSSPSGQGATERKS 197

  Fly   120 HPKLSHPCFNCDEKFGNAVDLDEHHRLAHQTPAF---------------LSRCLMCSIYGIHSAT 169
            ...:..|           |::......|.|:.|.               :.|||.||        
Mouse   198 ETMVDIP-----------VNMGSPQTHAVQSAAMAESGRRKWYAYEQYGMYRCLFCS-------- 243

  Fly   170 QQPNEYKCTQCGSICTTAMLAAGQQG-----FMEQQE--------AAVTP-----------DDQL 210
                 |.|.|...:.|.|...||:..     |..:.|        .:..|           |.:|
Mouse   244 -----YTCGQQRMLKTHAWKHAGEVNCSYPIFENENEPLGLLASSMSAAPGGVDAVVIAIGDSEL 303

  Fly   211 -----------------PAMAPRDMRLTPEEQHHQQQ---LQAEHHHQQQHQQQQQQQQQQQELL 255
                             |:.:|  :..:.||..|..|   |.|......:.....::......||
Mouse   304 SIHNGPSVQVQICSSDPPSSSP--LEQSTEEGVHLNQAVTLDANEEEMLEVMSDSEENLFADSLL 366

  Fly   256 EQQQR-----------------------------------EMQE-------QAQ-----QQQVHH 273
            ...|:                                   ||:|       :||     ...::|
Mouse   367 SSAQKIISSSPNKKGHVNVIVERLPSAEETLPPKHFLINAEMEEGKSPSPSEAQTGCVGAGNMYH 431

  Fly   274 ------------------HQQDQD----LAGDQVALKVPPLTVKLNKNA---------------- 300
                              .::|.:    ||.|:.|   ||...:.|..:                
Mouse   432 ADKCTVDIGGLIIGWSSAEKKDSELSKGLAPDENA---PPGRRRTNSESLRLHSLAAEALVTMPI 493

  Fly   301 ----------------------NGGAIVSHPQVIIKEEPLS-LSDSGDVVNSVPVYAIQANPGVP 342
                                  .|...||.|.....::.:| |.:|.|.|.|..    |:|..|.
Mouse   494 RAAELTRASLGHYGDINLLDPDTGQRQVSGPLATYSKKIMSPLKNSTDGVTSFN----QSNSTVV 554

  Fly   343 A-----------PASSGVLVGTQTVPADLAHKIRHKCPD------------CPKTFKTPGTLAMH 384
            |           ...:|:.:...||...|..:......|            |..  .:.|:|   
Mouse   555 ALPEGRQELSDGQVKTGISMSLLTVIEKLRERTDQNASDDDILKELQDNAQCQP--NSDGSL--- 614

  Fly   385 RKIHTGEADATP-KERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHI 448
              :.:...:..| .||||.|..|..|......:|||.|:|...:|:.|..||........|..|:
Mouse   615 --LGSNVVEYIPDAERPYRCRLCNYSSGNRGYIKQHLRVHRQRQPYQCPICEHIAENSKDLESHM 677

  Fly   449 RTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPL 482
            ..|...:.:.|..|.:.|..:|.|..|..:.|.|
Mouse   678 INHCKTRIHQCKQCKESFHYKSQLRNHEREQHCL 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 28/119 (24%)
C2H2 Zn finger 368..388 CDD:275368 4/31 (13%)
C2H2 Zn finger 403..423 CDD:275368 7/19 (37%)
C2H2 Zn finger 431..451 CDD:275368 5/19 (26%)
zf-H2C2_2 443..468 CDD:316026 6/24 (25%)
C2H2 Zn finger 459..480 CDD:275368 6/20 (30%)
Zfp507NP_808407.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..198 5/32 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..477 7/24 (29%)
C2H2 Zn finger 632..652 CDD:275368 7/19 (37%)
C2H2 Zn finger 660..680 CDD:275368 5/19 (26%)
C2H2 Zn finger 688..706 CDD:275368 6/17 (35%)
C2H2 Zn finger 748..768 CDD:275368
C2H2 Zn finger 776..796 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 823..856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.