DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cf2 and Zfp110

DIOPT Version :9

Sequence 1:	NP_001350854.1	Gene:	Cf2 / 33692	FlyBaseID:	FBgn0000286	Length:	537	Species:	Drosophila melanogaster
Sequence 2:	NP_001347505.1	Gene:	Zfp110 / 65020	MGIID:	1890378	Length:	832	Species:	Mus musculus

Alignment Length:	109	Identity:	52/109 - (47%)
Similarity:	71/109 - (65%)	Gaps:	7/109 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   367 KCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHC 431
            :|.:|.|.|:.....::|:|||||       ||||.|..|||:|.||::|.||.|||:||:||.|
Mouse   689 RCSECGKLFRNARYFSVHKKIHTG-------ERPYMCMACGKAFVQSSSLTQHLRIHSGERPFEC 746

  Fly   432 GYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVH 475
            ..|.::|:.:..:::|:|||||.|||.|..|.|.|.|.|.||.|
Mouse   747 SECGRTFNDRSAISQHLRTHTGAKPYHCERCGKAFRQSSHLTRH 790

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cf2	NP_001350854.1	COG5048	<366..>473	CDD:227381	49/105 (47%)
		C2H2 Zn finger	368..388	CDD:275368	6/19 (32%)
		C2H2 Zn finger	403..423	CDD:275368	11/19 (58%)
		C2H2 Zn finger	431..451	CDD:275368	5/19 (26%)
		zf-H2C2_2	443..468	CDD:316026	13/24 (54%)
		C2H2 Zn finger	459..480	CDD:275368	9/17 (53%)
Zfp110	NP_001347505.1	KRAB	18..77	CDD:214630
		SCAN	159..246	CDD:307924
		KRAB	283..324	CDD:307490
		C2H2 Zn finger	663..682	CDD:275370
		C2H2 Zn finger	690..710	CDD:275368	6/19 (32%)
		zf-H2C2_2	702..727	CDD:316026	15/31 (48%)
		C2H2 Zn finger	718..738	CDD:275368	11/19 (58%)
		zf-H2C2_2	730..754	CDD:316026	12/23 (52%)
		C2H2 Zn finger	746..766	CDD:275368	5/19 (26%)
		zf-C2H2	772..794	CDD:306579	10/19 (53%)
		C2H2 Zn finger	774..794	CDD:275368	9/17 (53%)
		zf-H2C2_2	786..811	CDD:316026	3/5 (60%)
		C2H2 Zn finger	802..822	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R4508
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940