DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and si:ch211-216l23.1

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_005159186.1 Gene:si:ch211-216l23.1 / 566696 ZFINID:ZDB-GENE-060503-121 Length:1372 Species:Danio rerio


Alignment Length:154 Identity:42/154 - (27%)
Similarity:73/154 - (47%) Gaps:23/154 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 NPGV----PAPASSGVL------------VGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRK 386
            :||:    .:|:|..|.            :|..|...:....:.:.|..|.|:|.....|..|.:
Zfish   106 DPGLSWVASSPSSKDVASPSQMLGDGCCDMGMGTGEEEGGSGLPYPCQFCDKSFSRLSYLKRHEQ 170

  Fly   387 IHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTH 451
            ||:.:.       |:.|::|.:.|....:..:|.::|||:|.:.|..||.:||..|:|..|::||
Zfish   171 IHSDKL-------PFKCTFCSRLFKHKRSRDRHVKLHTGDKKYSCQECEAAFSRSDHLKIHLKTH 228

  Fly   452 TGEKPYTCPYCDKRFTQRSALTVH 475
            :..||:.|..|.:.|:..|:|..|
Zfish   229 SSSKPFKCSICKRGFSSTSSLQSH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 33/106 (31%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 403..423 CDD:275368 4/19 (21%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 9/24 (38%)
C2H2 Zn finger 459..480 CDD:275368 6/17 (35%)
si:ch211-216l23.1XP_005159186.1 COG5048 <151..256 CDD:227381 35/109 (32%)
C2H2 Zn finger 152..172 CDD:275368 6/19 (32%)
C2H2 Zn finger 180..200 CDD:275368 4/19 (21%)
COG5048 206..>539 CDD:227381 18/47 (38%)
C2H2 Zn finger 208..228 CDD:275368 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 6/17 (35%)
C2H2 Zn finger 288..307 CDD:275368
C2H2 Zn finger 439..460 CDD:275368
C2H2 Zn finger 471..492 CDD:275368
C2H2 Zn finger 515..534 CDD:275368
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 707..728 CDD:275368
C2H2 Zn finger 738..755 CDD:275368
C2H2 Zn finger 766..783 CDD:275368
C2H2 Zn finger 796..817 CDD:275368
C2H2 Zn finger 833..853 CDD:275368
C2H2 Zn finger 859..877 CDD:275368
C2H2 Zn finger 956..977 CDD:275368
C2H2 Zn finger 1002..1022 CDD:275368
C2H2 Zn finger 1031..1051 CDD:275368
C2H2 Zn finger 1288..1308 CDD:275368
C2H2 Zn finger 1319..1340 CDD:275368
C2H2 Zn finger 1349..1365 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.