Sequence 1: | NP_001350854.1 | Gene: | Cf2 / 33692 | FlyBaseID: | FBgn0000286 | Length: | 537 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536681.2 | Gene: | Fezf2 / 54713 | MGIID: | 1859823 | Length: | 455 | Species: | Mus musculus |
Alignment Length: | 240 | Identity: | 73/240 - (30%) |
---|---|---|---|
Similarity: | 95/240 - (39%) | Gaps: | 60/240 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 291 PLTVKLNKN----ANGGAIVSHPQVIIKEEPLSLSDS----------GDVVNS-------VPVYA 334
Fly 335 IQANPGVPAPASSGV----------LVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHT 389
Fly 390 GEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGE 454
Fly 455 KPYTCPYCDKRFTQRSALTVHTTKLHPLXGRPGGGRQLPVPAPAA 499 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cf2 | NP_001350854.1 | COG5048 | <366..>473 | CDD:227381 | 41/106 (39%) |
C2H2 Zn finger | 368..388 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 403..423 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 431..451 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 443..468 | CDD:316026 | 12/24 (50%) | ||
C2H2 Zn finger | 459..480 | CDD:275368 | 7/20 (35%) | ||
Fezf2 | NP_536681.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
Engrailed homology 1 repressor | 27..42 | ||||
C2H2 Zn finger | 274..294 | CDD:275368 | 4/19 (21%) | ||
COG5048 | <284..>390 | CDD:227381 | 35/121 (29%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 1/19 (5%) | ||
zf-H2C2_2 | 317..339 | CDD:404364 | 9/29 (31%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 8/19 (42%) | ||
SFP1 | <380..436 | CDD:227516 | 23/55 (42%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 414..432 | CDD:275368 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |