DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and scrt1b

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001014369.1 Gene:scrt1b / 541533 ZFINID:ZDB-GENE-050327-72 Length:279 Species:Danio rerio


Alignment Length:214 Identity:60/214 - (28%)
Similarity:94/214 - (43%) Gaps:37/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 KVP-PLTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPV---YAIQANPGVPAPASSG 348
            ||| |..:..:.:::.||    |.....:.|.|...||.:.....|   |.:.|.......:...
Zfish    59 KVPSPGPIYDSNHSDYGA----PDSDQPDSPQSEITSGYINGDNAVSEGYTVDAFFITDGRSRRK 119

  Fly   349 VLVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERP------------- 400
            |:.|::|:.       ||.|.:|.||:.|...|:.|::.|........|:.|             
Zfish   120 VISGSRTLQ-------RHTCNECGKTYATSSNLSRHKQTHRSLDSKMAKKCPTCGKVYVSMPAMA 177

  Fly   401 ---------YTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKP 456
                     :.|..|||:|::...|:.|.|.|||||||.|.:|.|:|:.:..|..|::||:..|.
Zfish   178 MHLLTHDLKHKCDICGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKH 242

  Fly   457 YTCPYCDKRFTQRSALTVH 475
            :.|..|:|.|..:|.|..|
Zfish   243 FKCKRCNKTFVLKSYLNKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 40/128 (31%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 443..468 CDD:316026 9/24 (38%)
C2H2 Zn finger 459..480 CDD:275368 7/17 (41%)
scrt1bNP_001014369.1 zf-C2H2 130..152 CDD:278523 8/21 (38%)
C2H2 Zn finger 132..152 CDD:275368 7/19 (37%)
C2H2 Zn finger 163..180 CDD:275371 1/16 (6%)
COG5048 187..>263 CDD:227381 31/75 (41%)
zf-C2H2 187..209 CDD:278523 8/21 (38%)
C2H2 Zn finger 189..209 CDD:275368 8/19 (42%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-C2H2 217..237 CDD:278523 6/19 (32%)
zf-H2C2_2 229..253 CDD:290200 8/23 (35%)
C2H2 Zn finger 245..261 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.