DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and zgc:165514

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001092705.1 Gene:zgc:165514 / 449909 ZFINID:ZDB-GENE-041008-169 Length:298 Species:Danio rerio


Alignment Length:246 Identity:72/246 - (29%)
Similarity:109/246 - (44%) Gaps:49/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 HHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKN 299
            |...::|..|.:..:|:::|.|::.::     :.:..|.|             ..|.......:.
Zfish    11 HEDAEEHTDQMEVNEQREDLNEEKDKQ-----RTKTTHLH-------------SCPQCGKSFRRK 57

  Fly   300 ANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKI 364
            ||   :..|.:....|:|.:.::.|...:.:..|...                 |....|   |.
Zfish    58 AN---LNMHRKTHAGEKPYTCTECGKSFSQLNNYKQH-----------------QKTHED---KR 99

  Fly   365 RHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPF 429
            .|.|..|.|:|...|.|..|:.||||       |:|:.||||.|||::|..|:.|.|||||||||
Zfish   100 DHDCLQCGKSFTRAGGLKRHQMIHTG-------EKPHKCSYCEKSFSRSGHLRVHERIHTGEKPF 157

  Fly   430 HCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLH 480
            .|..|...|.:...|.:|:|.||.||||.|.:|:|||::.:....| .|.|
Zfish   158 TCTQCGHDFRLSSDLKQHMRIHTNEKPYACLFCEKRFSRLAHCKQH-QKTH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 50/106 (47%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 11/19 (58%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 443..468 CDD:316026 14/24 (58%)
C2H2 Zn finger 459..480 CDD:275368 7/20 (35%)
zgc:165514NP_001092705.1 C2H2 Zn finger 47..67 CDD:275368 4/22 (18%)
zf-H2C2_2 59..84 CDD:290200 5/27 (19%)
COG5048 <71..259 CDD:227381 59/165 (36%)
C2H2 Zn finger 75..95 CDD:275368 3/36 (8%)
C2H2 Zn finger 103..123 CDD:275368 7/19 (37%)
zf-H2C2_2 116..140 CDD:290200 15/30 (50%)
C2H2 Zn finger 131..151 CDD:275368 11/19 (58%)
C2H2 Zn finger 159..179 CDD:275368 6/19 (32%)
zf-H2C2_2 171..196 CDD:290200 14/24 (58%)
C2H2 Zn finger 187..207 CDD:275368 7/20 (35%)
C2H2 Zn finger 215..235 CDD:275368
zf-H2C2_2 227..250 CDD:290200
C2H2 Zn finger 243..263 CDD:275368
C2H2 Zn finger 271..289 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.