Sequence 1: | NP_001350854.1 | Gene: | Cf2 / 33692 | FlyBaseID: | FBgn0000286 | Length: | 537 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092705.1 | Gene: | zgc:165514 / 449909 | ZFINID: | ZDB-GENE-041008-169 | Length: | 298 | Species: | Danio rerio |
Alignment Length: | 246 | Identity: | 72/246 - (29%) |
---|---|---|---|
Similarity: | 109/246 - (44%) | Gaps: | 49/246 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 235 HHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKN 299
Fly 300 ANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKI 364
Fly 365 RHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPF 429
Fly 430 HCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLH 480 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cf2 | NP_001350854.1 | COG5048 | <366..>473 | CDD:227381 | 50/106 (47%) |
C2H2 Zn finger | 368..388 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 403..423 | CDD:275368 | 11/19 (58%) | ||
C2H2 Zn finger | 431..451 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 443..468 | CDD:316026 | 14/24 (58%) | ||
C2H2 Zn finger | 459..480 | CDD:275368 | 7/20 (35%) | ||
zgc:165514 | NP_001092705.1 | C2H2 Zn finger | 47..67 | CDD:275368 | 4/22 (18%) |
zf-H2C2_2 | 59..84 | CDD:290200 | 5/27 (19%) | ||
COG5048 | <71..259 | CDD:227381 | 59/165 (36%) | ||
C2H2 Zn finger | 75..95 | CDD:275368 | 3/36 (8%) | ||
C2H2 Zn finger | 103..123 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 116..140 | CDD:290200 | 15/30 (50%) | ||
C2H2 Zn finger | 131..151 | CDD:275368 | 11/19 (58%) | ||
C2H2 Zn finger | 159..179 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 171..196 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 187..207 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 215..235 | CDD:275368 | |||
zf-H2C2_2 | 227..250 | CDD:290200 | |||
C2H2 Zn finger | 243..263 | CDD:275368 | |||
C2H2 Zn finger | 271..289 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |