DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CG4730

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster


Alignment Length:301 Identity:65/301 - (21%)
Similarity:100/301 - (33%) Gaps:99/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 QEAAVTPDDQLPAMAPRDMRLTPEEQHH--------QQQLQAEHHHQQQHQQQQ--------QQQ 248
            ||||::..|........|:|..|:.:..        :.:...:.|.:.....||        :..
  Fly    68 QEAALSYYDCYEICTKEDLRQNPKNEPRTLCKRCAVELKWAYDFHKKMAIANQQLREIFVATEAN 132

  Fly   249 QQQQELLEQQQRE--MQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQV 311
            .:|::.:|.::.|  |.|:...:::...|                                    
  Fly   133 TEQEDDVEDEENEADMNEEFLMEEIEEKQ------------------------------------ 161

  Fly   312 IIKEEPL-SLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTF 375
               |.|: ||.|                                .||.: .|..:..|..|.|.|
  Fly   162 ---ETPIDSLED--------------------------------IVPRN-RHTGKSNCKFCHKEF 190

  Fly   376 KTPGTLAMHRKIHTGEADATPKERP-YTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFS 439
            :....:|.|:.||..       .|| :.||.|.:.:.....||.|......:...||..|.|.|:
  Fly   191 RNHSRMAKHQMIHLA-------NRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKVFA 248

  Fly   440 VKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLH 480
            :...|..|.|.|..:.||:|..||:||.|||.||||....|
  Fly   249 IAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKH 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 35/107 (33%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 403..423 CDD:275368 6/19 (32%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 11/24 (46%)
C2H2 Zn finger 459..480 CDD:275368 12/20 (60%)
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 11/55 (20%)
C2H2 Zn finger 183..203 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
C2H2 Zn finger 268..289 CDD:275368 12/20 (60%)
C2H2 Zn finger 296..318 CDD:275368
C2H2 Zn finger 325..346 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.