DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CG4820

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:396 Identity:89/396 - (22%)
Similarity:123/396 - (31%) Gaps:152/396 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQ-----PNEYKCTQCGSICTT 186
            |..|    |..|..||..::.  |||  .|.|:..:..|.:...|     || :.||.|      
  Fly     5 CRTC----GKTVVADECLQIF--TPA--GRKLLQCVRSITNCWLQNVQDLPN-HICTDC------ 54

  Fly   187 AMLAAGQQGF--------------------------MEQ---QEAAVTPD----DQLPAMAPRDM 218
            .:|.:..|.|                          |||   |:|| .||    |:|  |:..|:
  Fly    55 QVLLSQVQKFRRRCAKIEKYFARRRRRMNLGEAPAAMEQLRVQQAA-APDPLGIDEL--MSASDI 116

  Fly   219 RLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGD 283
            ::.|      .|||.|...|..:.:.|.:|                                   
  Fly   117 KIEP------IQLQMEEDPQAPYPENQLEQ----------------------------------- 140

  Fly   284 QVALKVPPLTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSG 348
              ||..        .||.|..|:..|:           |.|:....|..                
  Fly   141 --ALSY--------GNAPGEDILPLPE-----------DYGEAQTEVAT---------------- 168

  Fly   349 VLVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKE---------RPYTCS 404
                |...||....|...|......|.:. |...:|.|:..   |..||.         :|..|.
  Fly   169 ----TTNEPAQRRSKNTAKIKSKKHTMRV-GRKLIHVKVID---DKQPKRIVDRNGPSAKPCICE 225

  Fly   405 YCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQR 469
            :||:.|..::.|..|...|||.|||.|..|.:.......|.:|...|| |.||.|.:|...::..
  Fly   226 HCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHT-EGPYACTFCGLEYSTN 289

  Fly   470 SALTVH 475
            |:...|
  Fly   290 SSRVRH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 33/115 (29%)
C2H2 Zn finger 368..388 CDD:275368 4/19 (21%)
C2H2 Zn finger 403..423 CDD:275368 6/19 (32%)
C2H2 Zn finger 431..451 CDD:275368 4/19 (21%)
zf-H2C2_2 443..468 CDD:316026 9/24 (38%)
C2H2 Zn finger 459..480 CDD:275368 4/17 (24%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 21/84 (25%)
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 4/19 (21%)
C2H2 Zn finger 279..297 CDD:275368 4/17 (24%)
C2H2 Zn finger 322..339 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.