DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and M1BP

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:457 Identity:100/457 - (21%)
Similarity:162/457 - (35%) Gaps:145/457 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CPMCHQQ---------FERPQ-HVADHMQLCHGITLNAQGAIATLDGGHPQAQQHPKLSHPCFNC 130
            |.:|.:.         |||.. .:.|:::...|:.|...|.:.               ...|..|
  Fly    13 CRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLP---------------DQICECC 62

  Fly   131 DEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCGSICTTAMLAAGQQG 195
            ..:..:||.|.|             ||:......:...|::.                    :||
  Fly    63 SMELASAVKLRE-------------RCIAAQRELLLGLTEEQ--------------------RQG 94

  Fly   196 FMEQQEAAV----------TPDDQLPAMAPRDMRL-TPEEQHHQQQLQAEHHHQQQHQQQQQQQQ 249
            ......|||          ||||.......:::.| .|:|:....:::.::.:.:. .:....:.
  Fly    95 ISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDDTKVEYDNTYYEV-AEGHAGED 158

  Fly   250 QQQELLEQQQRE--MQEQAQQQQVHHHQQDQDL------------AGDQVALKVPPLTVKLNKNA 300
            ....|:|:...:  |.|..:|||.....:|.:|            :.|:||:    |...|:.. 
  Fly   159 DAASLIEEADYDSIMAEDEEQQQTLELDEDTELIVGDVNDAYVYDSDDEVAV----LDNVLDDE- 218

  Fly   301 NGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAP----------ASSGVLVGTQT 355
                 ..|..:::|:            .|:|          |.|          .:.||.:..|.
  Fly   219 -----YEHENIVVKK------------CSLP----------PKPKVRSDDARRRGTGGVYICEQC 256

  Fly   356 ---VPADLA---HKIRHK------CPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGK 408
               :...:|   |..||:      |..|...|.|...|..|.:.|||       |||:.|.|||:
  Fly   257 GNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTG-------ERPFACKYCGR 314

  Fly   409 SFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALT 473
            .||...|..:|.|.||.|:|:.||.|.|:|:....|..|:..|:||:.|.|..|||.|...:.|:
  Fly   315 CFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLS 379

  Fly   474 VH 475
            .|
  Fly   380 TH 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 42/112 (38%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 403..423 CDD:275368 9/19 (47%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 11/24 (46%)
C2H2 Zn finger 459..480 CDD:275368 7/17 (41%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 17/98 (17%)
C2H2 Zn finger 253..273 CDD:275368 3/19 (16%)
COG5048 276..>331 CDD:227381 22/61 (36%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 293..317 CDD:290200 12/30 (40%)
C2H2 Zn finger 309..329 CDD:275368 9/19 (47%)
zf-H2C2_2 324..346 CDD:290200 11/21 (52%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
zf-H2C2_2 350..372 CDD:290200 10/21 (48%)
C2H2 Zn finger 365..383 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.