DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and ranshi

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster


Alignment Length:284 Identity:72/284 - (25%)
Similarity:120/284 - (42%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 QQQHQQQQQQQQQQQELLEQQQRE----MQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNK 298
            ||....:::..:.|:|||..|..|    :.:::.:..:...:.:.|||  :::::|..|     .
  Fly    60 QQAISFRERCLEVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLA--EISIEVERL-----D 117

  Fly   299 NANGGAIVS---------HPQVIIKEEPLSLSDSGDVVNSVPVYAI-------QANPGVPAPASS 347
            :.|.|.|.|         :...|.::||   ::..|:..|...|.|       .|...:.:.:.:
  Fly   118 DLNEGPIQSSGFKVEDILNESKINEDEP---NNEDDIDYSEMDYLIYESDTEVDAKQELKSDSEN 179

  Fly   348 GVLVGTQTVPAD--------------------LAHKIRHK------CPDCPKTFKTPGTLAMHRK 386
            ......:..|.|                    :.|..||:      |..|...|.||..|..|.:
  Fly   180 PKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIR 244

  Fly   387 IHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTH 451
            .|||       |:|:.|.:|.:||:..:|..:|.|.||.|:||.|..|..:|:....|..|:..|
  Fly   245 KHTG-------EKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVH 302

  Fly   452 TGEKPYTCPYCDKRFTQRSALTVH 475
            ||||.:.|..|||.|::.:.||.|
  Fly   303 TGEKAFRCDLCDKLFSRYTHLTTH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 40/112 (36%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 7/19 (37%)
C2H2 Zn finger 431..451 CDD:275368 5/19 (26%)
zf-H2C2_2 443..468 CDD:316026 12/24 (50%)
C2H2 Zn finger 459..480 CDD:275368 8/17 (47%)
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 4/16 (25%)
C2H2 Zn finger 198..218 CDD:275368 1/19 (5%)
COG5048 222..>276 CDD:227381 20/60 (33%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 10/30 (33%)
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
zf-H2C2_2 269..291 CDD:290200 10/21 (48%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.