DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CG14655

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:448 Identity:111/448 - (24%)
Similarity:171/448 - (38%) Gaps:126/448 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQHPKLSHPCFNCDEKFGNAVDL 140
            ||:|                    .:.:.|:|..|.....:|...| |:.|..||.|.|   :.|
  Fly     8 CPLC--------------------AVPSFGSIDALQQRLIKAANGP-LACPFANCKELF---LGL 48

  Fly   141 DE--HHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCGSICTTAMLAAGQQGFMEQQEAA 203
            |:  .|..:|.:       ||........|..||                  |..:||:    ||
  Fly    49 DKLTIHLFSHTS-------LMAQEGNESPANGQP------------------ASSRGFL----AA 84

  Fly   204 VTPDDQL------PAM-APRDMRLTP-------EEQHHQQQLQAEHHHQQQHQQQQQQQQQQQEL 254
            ..|..:.      |.: .|..:|.||       |......:|: :.|.:..|:..:.:.:|:   
  Fly    85 APPKRRAKRTRSKPVVPTPPPVRTTPPAHCDICEFSFRNTELR-DMHVRLVHENAEGEPKQK--- 145

  Fly   255 LEQQQREMQEQAQQQQVHHHQQDQDLAGD-QVALK------VPPLTVKLNKN------ANGGAIV 306
             |.||:|..:  :..:.|...:...:.|. ::.||      ||......|.|      :...|:.
  Fly   146 -EPQQKEPDQ--EPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVT 207

  Fly   307 SHPQVIIKE-----EPLSLSDSGD--VVNSVPVYA-------IQANPGVPAPASSGVLVGTQTVP 357
            :.|::.|.:     ||.:|.:..:  ...|.| ||       :|.:|..|..       ||.|..
  Fly   208 ATPKLSICDRIRHTEPGALGNGNNSTCTASQP-YALSGALSMLQQSPSSPES-------GTATPK 264

  Fly   358 ADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRI 422
            .       .:|..|.|:|.|...|..|:::|||       |.||||..|.::||...:..:|...
  Fly   265 L-------WECDVCSKSFTTKYFLKKHKRLHTG-------EMPYTCEICARTFTFQQSYHKHLLY 315

  Fly   423 HTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLH 480
            |:..||..||.|.::|.....|..|.|.|:||||:.|..|.|.|.||.:..|| |::|
  Fly   316 HSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVH-TRIH 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 40/106 (38%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 5/19 (26%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 12/24 (50%)
C2H2 Zn finger 459..480 CDD:275368 9/20 (45%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 11/29 (38%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 11/21 (52%)
C2H2 Zn finger 352..372 CDD:275368 9/20 (45%)
zf-H2C2_2 364..389 CDD:290200 4/10 (40%)
C2H2 Zn finger 380..396 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.